(data stored in ACNUC9543 zone)

EMBL: CP000308.PE158

CP000308.PE158       Location/Qualifiers
FT   CDS_pept        191274..192038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0158"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12127"
FT                   /db_xref="GOA:A0A0H2Y4M6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4M6"
FT                   /protein_id="ABG12127.1"
FT                   /translation="MANICWIYYMPVHASIEPLGWESEFFQRQSAKLIFSDSAPPLNPA
FT                   ELAAFTLVQAKVPTHRLDLIDALSQLDFHLVEGEIDLSLVVGEKEGIGTENATSEPNMG
FT                   AYSLRVATEADIPQLRRVAASAFALSRFRAPWYDAQDSGRFYALWVEKAVLGTFDHQCL
FT                   LVLDPTDQPVGFVTLRDLQDGSARIGLLAVFPGAQSKGIGLRLMSAAKQWCQHHGLHRL
FT                   RVATQMSNIAALRLYIRSGASIESTAYWLCRG"
     atggcaaata tctgttggat ctattacatg cccgtccacg ccagtattga gccactgggc        60
     tgggaaagtg aatttttcca gcgccaaagt gcaaaattga ttttttccga ctcagccccg       120
     ccacttaacc cggctgagtt ggctgctttt actctcgttc aggctaaagt acctactcat       180
     cgccttgatc ttatagatgc cctgagccaa cttgattttc atttggttga aggggaaatt       240
     gatctgtcgc tggtcgtggg tgaaaaagaa ggtattggca cggaaaatgc tacatcagaa       300
     cccaatatgg gggcctactc gctacgggtt gccaccgagg cagatattcc gcagttgcgc       360
     cgtgttgctg ccagtgcttt tgccttaagc cgctttcgtg cgccttggta tgacgcacag       420
     gacagtgggc gattttatgc tttgtgggtt gaaaaggcgg tgctgggaac ctttgatcac       480
     caatgtttat tggtgctcga ccctacggat caacccgtcg ggtttgtgac gttgcgtgac       540
     ttgcaagacg ggagtgcgcg tattggcctg ttggccgtat tccccggtgc acagagtaaa       600
     ggtatagggt taagattaat gtcggcggcg aagcagtggt gccagcatca tgggttacac       660
     cggttacggg tagccacaca aatgagcaat attgctgctt tacgtctcta tattcgtagt       720
     ggtgcctcca ttgagagtac cgcgtattgg ttatgcaggg gatga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page