(data stored in ACNUC9543 zone)

EMBL: CP000308.PE164

CP000308.PE164       Location/Qualifiers
FT   CDS_pept        198170..199561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0164"
FT                   /product="putative permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12133"
FT                   /db_xref="GOA:A0A0E1NPP3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPP3"
FT                   /protein_id="ABG12133.1"
FT                   /translation="MADNAEKKGLHRGLEARHIELIALGGTIGVGLFMGSASTLKWAGP
FT                   SVLLAYIIAGLFVFFIMRAMGEMLYLEPVAGSFAVYAHKYLSPYFGYLTAWGYWFMWIA
FT                   VGISEITAIGVYVQFWFPEIPQWLPAIAGVAIVALANLAAVKLYGELEFWFAMIKVTTI
FT                   IVMILVGLGVIFFGFGNHGQPIGFDNLTAHGGFFAGGWKGFLFALCIVVASYQGVELVG
FT                   ITAGEARNPQVTLRRAINNILWRILIFYVGAIFVIVTIFPWNGIGTEGSPFVLTFAKIG
FT                   IVAAAGIINFVILTAALSGCNSGMYSGGRMLYALAKNRQLPAGLTKLSASGVPVYCIAI
FT                   TILCLLVGSSLNYIIPNPQQVFVYVYSASVLPGMVPWFVVLVCQLRFRQVHKAALQQHP
FT                   FKSILFPYVNYLTIAFLICVLVGMGINPDTRLSLLVGAIFLALVTGCYFVLGMHKPKAM
FT                   EAERL"
     atggcagaca acgcagagaa aaaaggatta caccgtgggc tggaagctcg gcatatcgaa        60
     ctgatagcgt tgggcggtac cattggtgtc gggttattta tggggtcagc aagcacgttg       120
     aaatgggcag ggccgtcagt attactggct tatatcattg cgggcttatt tgtattcttc       180
     attatgcgcg caatggggga aatgctgtat ctggagcccg tggctggatc cttcgcagtc       240
     tatgcgcata agtatctcag tccctatttt ggctatctga cggcttgggg ctactggttt       300
     atgtggattg cggtggggat atctgaaatt accgccattg gcgtctatgt tcagttttgg       360
     ttcccagaaa tcccgcaatg gctaccggct atcgctgggg tggcgattgt ggcattagcg       420
     aatctggctg cggtcaaatt gtatggcgag ctagagtttt ggtttgccat gatcaaggtc       480
     acgacgatca ttgtgatgat tttggttggc ttaggcgtga tattttttgg cttcggtaat       540
     cacggccagc cgattggctt cgataacctg accgcccatg gcggtttctt tgccgggggg       600
     tggaaaggct tcctgtttgc gctgtgtatt gtggtcgcgt cttaccaagg tgttgaactg       660
     gtcggtatta cggcgggaga agccagaaat ccacaggtga cgttaagaag agcgatcaac       720
     aacatcttat ggcgaatttt gattttctac gtcggtgcaa tatttgtcat tgtcaccatt       780
     tttccctgga atgggattgg tacagagggt agccccttcg tactgacctt cgccaaaata       840
     ggaatagtgg ccgcggcggg tattattaac ttcgtgatac tgaccgccgc tctctcaggt       900
     tgtaacagtg gtatgtatag cggcgggcgt atgttgtatg ccttggcaaa aaatcgtcag       960
     ctaccggccg gcctgaccaa actgtcggct agcggtgtac cggtgtactg cattgcgatc      1020
     accatcctgt gtctactggt ggggtcgagc ctgaattaca ttattcccaa cccgcagcaa      1080
     gtgtttgttt atgtctacag tgccagcgtg ttacctggca tggtgccgtg gtttgtggtc      1140
     ttggtctgtc agttacgttt tcggcaggta cataaagctg ccctacagca gcacccgttt      1200
     aaatctatcc tattccccta tgtgaactac ctcaccatcg cattcctgat ttgtgtatta      1260
     gtgggaatgg ggataaaccc agatactcgc ttatcattac tggttggggc aatttttctg      1320
     gcattagtga cgggatgcta ttttgtgctg gggatgcata aacccaaggc catggaagcg      1380
     gaacgcctat aa                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page