(data stored in ACNUC9543 zone)

EMBL: CP000308.PE167

CP000308.PE167       Location/Qualifiers
FT   CDS_pept        202890..203036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y2E3"
FT                   /protein_id="ABG12136.1"
FT                   /translation="MGRWWRYKWITFHPSLTVIKTPFDLLKQFAVWQLQMFNKKSKGGP
FT                   NEG"
     ttgggccgtt ggtggagata taagtggatc acttttcatc cgtcgttgac agttataaaa        60
     accccttttg atttgttaaa acagtttgcg gtctggcaac tgcaaatgtt caacaagaaa       120
     tcaaaagggg gtcccaatga gggatga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page