(data stored in ACNUC9543 zone)

EMBL: CP000308.PE175

CP000308.PE175       Location/Qualifiers
FT   CDS_pept        complement(211032..211352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0175"
FT                   /product="frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12144"
FT                   /db_xref="GOA:Q1CBM8"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBM8"
FT                   /protein_id="ABG12144.1"
FT                   /translation="MNDSEFHQLADQLMLYIEETLDSFTGDSDIDYETNGGVMTLTFEN
FT                   GSKIVINRQEPLHQVWLATKAGGYHFNYRDGHWYCSRSGEEFLAKLSEAASAQAGENVS
FT                   FG"
     atgaacgaca gcgagtttca tcagttagcc gatcaattga tgctttacat tgaagagaca        60
     ctggatagtt ttactggcga tagtgatatc gattatgaaa ccaatggcgg ggtgatgacc       120
     ctgaccttcg agaatggcag caagattgtg atcaaccgtc aggaaccctt gcatcaggta       180
     tggctggcga ccaaagcggg cggctaccac tttaattatc gtgacggcca ctggtattgc       240
     tcacgcagtg gcgaagagtt tttggctaaa ttgtccgaag cggccagtgc gcaagccggt       300
     gaaaatgtta gctttggtta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page