(data stored in ACNUC9543 zone)

EMBL: CP000308.PE182

CP000308.PE182       Location/Qualifiers
FT   CDS_pept        complement(217471..218157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0182"
FT                   /product="putative TetR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12151"
FT                   /db_xref="GOA:A0A0E1NYB8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYB8"
FT                   /protein_id="ABG12151.1"
FT                   /translation="MNTQNKQEGFSPSLTTIRARTRRLLIDTAMSMYERGAFPSITEVA
FT                   SAAQLSRATAYRYFPTQSALVSAMVDESLGPILAWQPTQPDARQRIAELLSFAYPRMLQ
FT                   HEGVLRAALHLSLQQWADARNSDSNNNSNDSNNSSNEEKLIRGNRKRLLKLAVEPLEET
FT                   LAPEALQRVIHAFSLIYGSEVFMVLKDIWHLDEAGIQDVTQWMGKAILLQAETDSQLAA
FT                   QDKTHS"
     gtgaatactc agaataaaca agaaggtttc tctccatcgt taacgaccat tagagccaga        60
     acccggcggt tacttattga taccgccatg tcgatgtatg aacgtggtgc attcccatca       120
     atcaccgaag tcgccagtgc ggctcagctt tctcgtgcta ctgcttaccg ttactttccg       180
     acacaaagcg cattggtttc agccatggtc gatgagagcc tcggtccaat attggcttgg       240
     caacccaccc aaccggatgc acggcagcgt atcgccgaat tattgtcctt tgcttatccg       300
     cgcatgttgc aacatgaagg cgtgttacgt gcagcgctgc acttatcgct acagcaatgg       360
     gctgatgccc gcaacagtga cagtaataac aacagcaatg acagtaataa cagcagcaat       420
     gaagaaaagt taatccgtgg gaaccgtaaa cgattactga aattggccgt cgagccactg       480
     gaagagacgt tggcaccaga ggccttgcaa cgggtgatcc atgccttttc attaatctat       540
     ggctctgaag tttttatggt gctgaaagat atttggcatc tggacgaagc ggggattcag       600
     gatgtaaccc agtggatggg caaggccatt ttgttgcaag ctgaaaccga ttcccaactg       660
     gcggctcagg acaaaactca ttcgtga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page