(data stored in ACNUC9543 zone)

EMBL: CP000308.PE186

CP000308.PE186       Location/Qualifiers
FT   CDS_pept        complement(222355..223245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0186"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12155"
FT                   /db_xref="GOA:A0A0E1NMZ3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMZ3"
FT                   /protein_id="ABG12155.1"
FT                   /translation="MDKQQTRQGIFFALAAYFIWGLAPAYFKLIQQVPADEILTHRVIW
FT                   SFFFMLILLTVSRHWPQVRDACKNRKRLLLLAVTAVLIASNWLLFIWAVNHNHMLEASL
FT                   GYFINPLVNVLFGMLFLGERFRRMQWVAVALAFAGVLIQLWQFGSLPVIGLGLAITFAL
FT                   YGLLRKKLGVDAQTGMLIETMWLLPVAAVYLFFIADSPTSHLSANAWSLNLLLAAAGVI
FT                   TTIPLLFFTAAATRLRLSTLGFFQYLGPTLMFILAVTFYGETIGNDKMVTFIFIWAALL
FT                   LFTLDALYTQRKLRR"
     atggataaac aacaaactcg tcagggcatt ttttttgctc tggctgccta ttttatttgg        60
     ggccttgctc ccgcgtattt caaactcatc caacaagtgc ccgctgatga gattctgacc       120
     cacagggtca tctggtcatt cttctttatg ttgattctgc ttaccgtcag ccgccattgg       180
     ccacaggtgc gcgacgcctg caaaaaccgt aagcgcctat tgttactggc ggtgaccgcc       240
     gttttgattg ccagtaactg gctgctgttt atctgggcgg tcaaccacaa tcacatgctg       300
     gaagccagtc tgggatattt cattaatccg ttggtcaatg tgctgtttgg catgttattt       360
     ctcggcgaac gctttcgtcg tatgcaatgg gtcgccgtgg cactcgcctt tgccggcgtg       420
     ctgattcaac tgtggcaatt tggttcactg ccagtgattg ggctgggtct ggccatcacc       480
     tttgctttat acggcttgtt gcgtaaaaag ctgggcgttg atgcccaaac cggtatgctc       540
     attgaaacca tgtggctgct accagtagcc gccgtatatc tgtttttcat cgccgacagc       600
     ccgaccagcc acctgagcgc caatgcctgg tcgctgaacc tgctgctagc cgctgcgggc       660
     gtcattacca caatcccact gctgttcttc accgcggcgg ccacccgttt gcgtctttcg       720
     acactgggtt tcttccagta tcttgggcca acattgatgt ttattttggc ggtgacgttc       780
     tacggtgaaa ccattggtaa tgacaagatg gtgaccttca tctttatctg ggcggccctg       840
     ctactgttta cgctggatgc actctatacc caacgcaaac tacgccggta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page