(data stored in ACNUC9543 zone)

EMBL: CP000308.PE187

CP000308.PE187       Location/Qualifiers
FT   CDS_pept        complement(223332..223802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12156"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZZ0"
FT                   /protein_id="ABG12156.1"
FT                   /translation="MSVTPLTLEDARRMIGETFVYHMPFNRELGLKLVRFEQDYAEITF
FT                   DNDDKLVGNIAQKILHGGVIAAVLDVAAGLVCVGNSLIRHEPLIQEQLQIKLAKMGTID
FT                   LRVDYLRPGRGEHFIARSSILRSGNKVAVARVELHNEKQIHIASATATYLVG"
     atgtcagtaa cgcccttaac actggaagac gctcgccgca tgatcggcga aacctttgtt        60
     tatcacatgc cattcaaccg tgaattaggg ctaaaattag tccgttttga acaagattat       120
     gccgaaatca ccttcgataa tgatgacaag ttggtgggta atatcgcgca aaagatcttg       180
     cacggtgggg tcattgccgc cgtattggat gttgccgcgg gtctggtttg tgttggcaat       240
     agcctgatac gccatgaacc actgattcaa gagcaactgc aaataaagct ggctaaaatg       300
     ggcactatcg atctacgcgt cgactatctg cgccctggcc gtggtgagca ttttatcgcc       360
     agaagcagta tcttacgcag tggaaacaaa gtggctgtcg cccgggttga actgcataat       420
     gaaaaacaaa ttcatatcgc cagcgcgacg gcgacctatc tggttggcta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page