(data stored in ACNUC9543 zone)

EMBL: CP000308.PE19

CP000308.PE19        Location/Qualifiers
FT   CDS_pept        24909..26636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0019"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /EC_number="2.7.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11988"
FT                   /db_xref="GOA:Q1CC34"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC34"
FT                   /protein_id="ABG11988.1"
FT                   /translation="MVAKLEQLIAQTILQGFDAQYGRFLEVTAGAQHRFEQADWHAVQQ
FT                   AMKKRIHLYDHHVGLVVEQLKYITDQRHFDVEFLARVKEIYTGLLPDYPRFEIAESFFN
FT                   SVYCRLFKHRDLTPDKLFVFSSQPERRFREIPRPLARDFIPKGDLSGMLQMVLNDLSLR
FT                   LHWENLSRDIDYIVMAIRQAFTDEQLASAHFQIANELFYRNKAAWLVGKLRLNGDIYPF
FT                   LLPIHHNESGELFIDTCLTSKAEASIVFGFARSYFMVYVPLPAAMVEWLREILPGKSTA
FT                   ELYTAIGCQKHGKTESYREYLAFIHQSSEQFIIAPGVKGMVMLVFTLPSFDRVFKVIKD
FT                   QFAPQKEVTQARVLECYQLVKEHDRVGRMADTQEYENFVIDKHRISPELLAELQHEVPE
FT                   KLEDLGDKIVIKHLYMERRMTPLNLYMEQADDQQLKDAIEEYGNAIKQLAAANIFPGDM
FT                   LFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDEMASEPWYSVSPNDVFPEE
FT                   FRHFLCSDRKVRHFFEEMHGDLFQASYWRGLQQRIRDGHVEDVFAYRRKQRFSQRALN"
     atggtggcaa agctagaaca acttatcgct cagaccattt tgcagggatt tgatgcgcaa        60
     tatggccgtt ttctggaggt cactgccggt gctcaacacc gttttgagca ggccgattgg       120
     catgcggtac agcaggcgat gaaaaagcgt attcaccttt atgatcacca tgtgggttta       180
     gtggttgagc aactgaaata cattacggat caacgccatt ttgatgtgga atttttggcg       240
     cgggtgaaag aaatttatac cgggctgcta ccggattatc cgcgcttcga aatcgccgaa       300
     agctttttta attcggttta ttgccgttta tttaaacacc gcgatttaac gcccgataag       360
     ttgtttgttt ttagctctca gcctgagcgg cgcttccgtg agatcccacg gcctctggcc       420
     cgcgatttca tccctaaagg ggatctcagt ggtatgttgc agatggtgct taatgattta       480
     tcactgcgct tacattggga aaatttgtcg cgagacattg attatatcgt gatggccata       540
     cggcaagcct ttaccgatga gcagctagcc agtgcgcatt ttcaaatagc gaatgagttg       600
     ttttaccgca ataaggccgc ttggttggtg ggtaaattga ggctgaacgg tgacatctat       660
     cctttcttgt tacctattca tcacaatgag tctggtgagc tatttattga tacctgtctg       720
     accagcaaag cggaggccag tatcgtgttc ggcttcgctc gttcttattt tatggtctat       780
     gtgccgctgc cggctgcaat ggtggaatgg ttacgggaaa tattaccggg taaatctacc       840
     gctgagctgt atacggcgat tggctgtcag aaacacggta aaacagagag ttatcgcgag       900
     tatttggctt ttattcatca atccagtgaa cagtttatta ttgcacctgg ggtgaaaggc       960
     atggtgatgt tggtctttac cttaccgtca tttgatcggg tatttaaggt gattaaagac      1020
     caatttgcac cacaaaaaga ggtcactcaa gcacgagttt tagaatgcta tcaattagtt      1080
     aaagaacatg accgggtagg gcgcatggcg gatacccaag agtatgaaaa ttttgtgatt      1140
     gataagcacc gtatcagccc agaactgctg gcggagttgc aacatgaagt acccgaaaaa      1200
     ctggaggatt taggtgacaa gatcgtcatt aagcacctgt atatggagcg aaggatgacc      1260
     ccgttaaatc tctatatgga gcaggcagat gatcagcagt tgaaggatgc tattgaggaa      1320
     tatggtaacg ccattaaaca actggctgcg gccaatattt tccccggtga tatgttattt      1380
     aagaacttcg gtgtgacgcg ccatgggcgg gtggtgttct acgattatga tgaaatttgt      1440
     tatatgaccg aggttaattt ccgcgatatt cccccaccgc gttatcccga agatgagatg      1500
     gccagtgagc cgtggtacag cgtgtctcct aatgatgttt ttcccgaaga gtttcgccat      1560
     ttcttatgca gtgaccggaa agtcaggcac ttttttgagg agatgcacgg cgatctgttc      1620
     caggccagtt attggcgcgg cttgcagcag cgtatccggg atgggcatgt ggaggatgtt      1680
     tttgcttata gacgaaagca acgcttctcc cagcgggctt taaattaa                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page