(data stored in ACNUC9543 zone)

EMBL: CP000308.PE191

CP000308.PE191       Location/Qualifiers
FT   CDS_pept        complement(227590..228210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0191"
FT                   /product="putative homoserine/homoserine lactone efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12160"
FT                   /db_xref="GOA:A0A0E1P024"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P024"
FT                   /protein_id="ABG12160.1"
FT                   /translation="MTLDWWLTYLLTTLILSLSPGSGAINTMSTAISHGTRGVVASIGG
FT                   LQLGLAVHIVLVGVGLGALVSQSLLAFEILKWLGAAYLIWLGIQQWRAAGSLDLHALAN
FT                   SMPRRKLFKRAVFVNLTNPKSIVFLAALFPQFVLPQQPQVAQYLILGSTSVIVDIIVMI
FT                   GYATLATRIARWIKSPQQMKLLNRIFGGLFMLIGALLATARKV"
     atgaccttag actggtggtt aacctatctg ctgacaacat tgatcctcag tctttctccc        60
     ggctcggggg ccattaacac aatgagcact gccatcagcc atggtacccg tggggttgtt       120
     gcttccattg gcgggttaca actgggtctg gcggtgcata tcgtcttggt tggcgtcggt       180
     cttggtgccc tggtctctca atccttactg gcatttgaaa tattaaagtg gctcggtgcg       240
     gcttacttaa tttggcttgg tattcaacaa tggcgtgcag ccgggtcgct tgacctgcat       300
     gcactggcaa acagtatgcc caggcgtaag ctgtttaaac gtgcggtgtt tgttaacctg       360
     accaatccaa aaagcattgt ttttctggcc gcgttatttc cacaatttgt actgccacag       420
     caaccgcagg tggcacagta tttgattttg ggcagcacca gtgtgattgt cgatattatc       480
     gtgatgattg gttatgccac tttggctaca cgtattgccc gttggattaa atcgccacag       540
     caaatgaaac tcttgaaccg aatatttggc ggcctattta tgttgattgg tgcattatta       600
     gccacagcgc gcaaagtata a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page