(data stored in ACNUC9543 zone)

EMBL: CP000308.PE194

CP000308.PE194       Location/Qualifiers
FT   CDS_pept        230540..231739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12163"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNT1"
FT                   /protein_id="ABG12163.1"
FT                   /translation="MSDINVTSPHFIPMKSPITARLDNSDLIDERPQKINFLGNKLNSI
FT                   ADVNIDSKNKKITINIAEKKFSSDYIPEEYIYIAVWDAKGKMVFQKKLSDAEIKEEKIE
FT                   LPFEVGYQLEMYHPIPSRLVSSPDLYSIIDSNSPFTLLVMTPLGVTNPKMESYPTDIIE
FT                   ADFIHPNSVSVGVNADVIEPASTAEPTTSTPIAPDIPSASTDPIVSTSTRTGIDSTTKL
FT                   MVSFQFKLLGVCDYDIATVTIDEESKLAGIKIVTDTPHCHFGDELYASIKVTDKQGHIT
FT                   FEEKLYGTNANISNTIIPFEKGYKLDIFHAEPSRLRVSSGDSDTLIPESKQNSFIMTSI
FT                   GIENTRQGSAEAIISDQFDTEKLVQDMSSFGDSSIAPVDNVYGYMGEKNHYQNVVSHVE
FT                   "
     atgagtgata taaacgttac ctccccccat ttcataccta tgaaaagtcc tattactgca        60
     agattagata atagtgattt gatcgatgaa cggcctcaga agattaattt tctcggtaat       120
     aaattaaact ccatagccga tgttaatatt gactcaaaaa ataaaaaaat aacaataaat       180
     attgctgaga agaaatttag tagtgactat attcctgagg agtatatcta tattgccgtg       240
     tgggatgcta aaggaaaaat ggtttttcaa aaaaaattat cagatgcaga gataaaagaa       300
     gagaaaatag aacttccatt tgaggtgggt tatcaacttg aaatgtacca ccctataccc       360
     agcagactcg ttagttctcc tgatctttat agtattattg actccaattc tccatttact       420
     cttcttgtaa tgacgccatt aggtgtgaca aatcctaaga tggaatctta tcctaccgat       480
     attatcgagg cggattttat tcatccaaac tccgtttcag tgggggtcaa tgcggatgtt       540
     attgaacctg catctacagc ggaacccaca acgtctaccc ctatcgctcc tgatatccct       600
     tctgccagca ccgatcccat cgtcagcacc agtacccgca cgggtatcga ttcgacaaca       660
     aaattgatgg tatcgttcca gttcaagctg ttgggcgtat gtgattatga tattgcgaca       720
     gtgaccatcg atgaagagag taaactggcg ggtattaaga ttgttactga caccccccat       780
     tgtcattttg gtgatgagct gtatgccagt attaaagtga ccgataaaca agggcacatc       840
     acgtttgagg aaaaacttta tggcacgaat gcgaatattt caaataccat tattcccttc       900
     gaaaaaggtt ataaattaga tatcttccat gctgagccta gccggttacg tgtttcatcc       960
     ggtgatagcg atactttaat tccagagtcc aagcagaata gttttatcat gacatcaatt      1020
     ggtatagaaa ataccaggca gggcagtgcc gaggcaataa tatcagatca attcgataca      1080
     gaaaaattgg ttcaagatat gtcttctttc ggtgattctt ccattgcgcc cgtggataat      1140
     gtctacggat acatgggtga aaaaaatcac tatcagaatg tagtgagtca cgttgaataa      1200
//

If you have problems or comments...

PBIL Back to PBIL home page