(data stored in ACNUC9543 zone)

EMBL: CP000308.PE196

CP000308.PE196       Location/Qualifiers
FT   CDS_pept        233553..235208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0196"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12165"
FT                   /db_xref="GOA:A0A0E1NST2"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NST2"
FT                   /protein_id="ABG12165.1"
FT                   /translation="MTNSSPYLETDVIIIGGGATGAGIARDCARRGLACTLLERHDIAT
FT                   GATGRNHGLLHSGARYAVTDGESARECIEENRILKRIARHCIEQTDGLFITLPEDSLAY
FT                   QLQFIARCRDAGIEAEAIDPAQALRLEPAVNPALIAAVRVPDGTVDPFRLTAANMLDAR
FT                   EHGANILTYHEVIGLLRQGSRINGVCVFDHKNQRKYDIHAQIVVNAAGIWGQHIAEYAD
FT                   LRIRMFPAKGALLILGHRINNMVINRCRKPADADILVPGDTISLIGTTSTHINYDQIDN
FT                   MVVTAQEVDTLIREGAKLSPQLAQTRILRAYAGVRPLVASDDDPSGRNVSRGIVLLDHA
FT                   SRDGVEGFITITGGKLMTYRLMAEWATDKVCEKLGISAACTTAQVPLPGSRQSAEQTLS
FT                   KVISLPASIRGSAVYRHGDRATQLLVGNRLDNSLVCECEAVTAGEVRYAVESLSVNNLL
FT                   DLRRRTRVGMGTCQGELCACRAAGLLSRFKVTTPQQSREQLTQFLNERWKGVRPIAWGD
FT                   ALRESEFTQWVYQGLCGLDEIPATVNAREKHDEI"
     atgacgaaca gttctcctta tctagaaacg gatgtcatca ttatcggtgg cggagcaacc        60
     ggtgccggaa tcgctcgcga ctgcgcccgc cgtggtttgg cttgtacttt attggaaagg       120
     catgacatcg ctactggggc cacggggcgt aatcatggtc tcctgcacag tggcgctcgc       180
     tatgcggtaa ccgacggtga gtcagcccgt gagtgcattg aagaaaaccg cattctcaaa       240
     cggattgctc gccactgcat tgaacaaacg gatggcttgt tcatcacctt gccggaagac       300
     tctctggcgt atcagctaca atttatcgcc cgttgtcggg atgcgggcat tgaggctgaa       360
     gccattgatc cggcacaggc actgcgcttg gagcctgccg tcaaccccgc gctgattgcc       420
     gcggtccggg tccctgatgg tactgtcgat cctttccgtt taaccgcggc taacatgttg       480
     gatgcccgcg aacatggcgc gaatattctg acatatcatg aagttatcgg tttgttgcgg       540
     cagggttccc gaatcaatgg tgtgtgcgtt ttcgaccata aaaatcagcg aaaatacgac       600
     attcatgcgc agattgtggt gaatgctgct gggatctggg gacaacatat tgctgaatat       660
     gccgatctgc gtatccgcat gttccccgcc aaaggcgcgt tgctgatcct cgggcatcgg       720
     atcaataaca tggtgatcaa ccgttgtcgt aagcctgcgg atgccgatat tttggtgccg       780
     ggcgatacca tttcattgat cggtaccacg tcaacccaca tcaattacga tcaaatagac       840
     aatatggtag taacggcaca agaggtggat acattaattc gtgaaggtgc caaactttcg       900
     ccgcaactgg cgcaaacccg tattttgcgt gcctacgcgg gagtgcggcc gctggttgcc       960
     agcgatgatg atccatcagg gcgtaatgtc agccgtggca tcgtattact ggatcatgcc      1020
     agccgggatg gggtggaggg ttttatcacg atcaccggtg gcaagctgat gacctaccgg      1080
     ctgatggcgg aatgggcaac cgataaagtg tgcgaaaagt tgggtatcag cgcagcttgt      1140
     accacagcgc aagtgccatt acccggctca cggcaatccg cagaacagac tttaagcaaa      1200
     gtgatctctt tgcctgccag cattcgcggt tcggcggttt atcgccatgg tgatcgtgcc      1260
     acgcagttgt tggtgggaaa ccggctggat aacagcctgg tgtgtgaatg tgaggcggtc      1320
     accgccggtg aagttcgcta cgcggttgaa tctttatcgg tcaataacct gttggattta      1380
     cgccgtcgta cccgtgtggg gatgggcact tgccagggag aactgtgcgc ttgccgtgca      1440
     gcgggcctac tcagccgctt taaggtgacc acaccgcagc aatcccgtga gcaactgaca      1500
     caatttctca acgagcgctg gaaaggtgta cgcccaattg cttggggtga tgcattgcgt      1560
     gagagtgagt ttacccagtg ggtctatcag ggactctgtg gtttggatga gattccagcc      1620
     accgtgaatg cgcgggagaa acacgatgaa atttga                                1656
//

If you have problems or comments...

PBIL Back to PBIL home page