(data stored in ACNUC9543 zone)

EMBL: CP000308.PE198

CP000308.PE198       Location/Qualifiers
FT   CDS_pept        236469..237764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0198"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12167"
FT                   /db_xref="GOA:A0A0H2Y4K2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4K2"
FT                   /protein_id="ABG12167.1"
FT                   /translation="MTGLPKHDASPEQDGMMVGDSRLTRDNSFESCIKCTVCTTYCPVA
FT                   KVNPLYPGPKQAGPDGERLRLKDPALYDDALKYCTNCKRCEVACPSDVKIGDIIQRAKA
FT                   SHSTNKPKLRDAILSHTDIMGTLSTPFAPVINAVTGLKPVRVLLDKALKIDHRRELPKY
FT                   SFGTFRRWYRKQAEKQQQYTEQVAFFHGCFVNYNHPQLGKDLVSVFNAMNIGVQLLKRE
FT                   KCCGVPLIVNGFIEQAKKQARVNLESLTDTVIGRDIPVVATSSSCTFTLRDEYPHLLDV
FT                   DTTPVRDKVELATRYLYRLLDQGRELPLKPLFSLNPLLASQEAPLRIAYHTPCHMEKMG
FT                   WTAYTLALLQRIPGVELVVLDSQCCGIAGTYGFKSENYATSQGIGASLFQQIEDSGVDL
FT                   VITDCETCKWQIEMSTSKKCEHPITLLARALA"
     atgacagggt tgccaaagca tgatgctagc cccgaacagg atggcatgat ggtgggcgat        60
     agccgtctca cgcgagataa tagcttcgaa agctgtatca aatgtacggt ctgtacgact       120
     tactgtccgg tggcaaaggt taacccactc tatccggggc cgaaacaagc tgggccggat       180
     ggtgaacgcc tgcgtctgaa agatccggca ctgtacgatg atgcgctgaa atattgtacc       240
     aactgtaaac gctgtgaagt ggcttgcccg tcagatgtca aaattggcga tattatccaa       300
     cgggcgaaag ccagccatag cactaacaaa cccaaattac gcgatgccat cctcagtcat       360
     accgacatca tgggcacgct ttcgacaccg tttgcaccgg tgatcaatgc ggtgacgggg       420
     ttgaaacccg ttcgggtatt gttggacaaa gcgctgaaaa ttgaccatcg acgtgaatta       480
     cccaaatact catttggtac ctttcgccgt tggtatcgca aacaggcgga aaaacagcag       540
     caatataccg agcaagttgc gtttttccat ggctgttttg tcaactataa ccaccctcaa       600
     ttaggcaagg atttagtcag cgttttcaat gcgatgaata tcggtgtgca gttgttgaaa       660
     cgtgaaaaat gctgtggtgt cccactgatt gtaaatggtt ttattgagca ggcgaaaaag       720
     caggcacggg taaacctaga atcactcact gatacggtca ttggccgtga tattccggta       780
     gtcgccacct cctcaagttg taccttcacc ctgcgggatg aatatcctca tttattagat       840
     gtggatacga ccccggtgcg cgataaagta gagttggcga ctcgctacct ttaccgctta       900
     ttggatcaag ggcgagagct acctctgaag cctttattct cattaaaccc cttattggca       960
     tctcaagaag ccccattgcg cattgcctat cacacacctt gtcatatgga gaaaatgggc      1020
     tggacggcct ataccctggc tttgctccaa cggatacccg gtgttgagct ggtggtgtta      1080
     gattctcaat gttgcggtat cgccgggacc tatggtttta aatcagaaaa ctacgcgaca      1140
     tcgcaaggga ttggggcatc gttgttccag caaattgagg atagcggggt tgatttggtg      1200
     attaccgatt gcgaaacctg caaatggcag atcgaaatgt cgaccagtaa gaaatgtgag      1260
     cacccgatta ctttactggc gcgggcattg gcttga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page