(data stored in ACNUC9543 zone)

EMBL: CP000308.PE2

CP000308.PE2         Location/Qualifiers
FT   CDS_pept        complement(803..1264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0002"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11971"
FT                   /db_xref="GOA:A0A0E1NNG4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNG4"
FT                   /protein_id="ABG11971.1"
FT                   /translation="MSEIYQIDNLDRSILKALMENARTPYAELAKNLTVSPGTIHVRVE
FT                   KMRQAGIITAACVHVNPKQLGYDVCCFIGIILKSAKDYPSALKKLESLEEVVEAYYTTG
FT                   HYSIFIKVMCKSIDALQQVLINKIQTIDEIQSTETLISLQNPIMRTIVP"
     atgagtgaaa tttatcagat cgataatctc gatcgcagca tcctgaaagc attaatggaa        60
     aatgcacgca caccctatgc tgaattagcc aaaaacctca ctgttagccc cggaactatt       120
     catgtaagag tagaaaagat gcggcaagca gggatcatta ccgcagcttg tgtacacgtt       180
     aacccaaaac aactgggtta cgacgtttgc tgctttattg gcataatctt gaaaagtgcc       240
     aaagattacc cttccgcctt gaaaaaattg gaaagcttag aagaagtggt tgaggcctat       300
     tacaccactg gccactacag catatttatt aaagtgatgt gtaaatccat tgatgcattg       360
     cagcaggtac ttatcaacaa aatccagact attgatgaga tccagtcaac cgagacacta       420
     atatcactgc aaaaccctat catgcgtacg atcgttcctt aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page