(data stored in ACNUC9543 zone)

EMBL: CP000308.PE200

CP000308.PE200       Location/Qualifiers
FT   CDS_pept        complement(238583..239251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0200"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12169"
FT                   /db_xref="GOA:A0A0E1NNP1"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNP1"
FT                   /protein_id="ABG12169.1"
FT                   /translation="MFSFTVQQRMTALVWLSLFHIVIITSSNYLVQLPIAIFGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAPLARRIILSVMVPALLISYLISALFYQGSWQGFPALTSF
FT                   NLVVARIAVASFMAYVLGQILDVQVFNRLRQRNAWWVAPTAAMFFGNISDTMAFFFIAF
FT                   YRSSDPFMAAHWVEIALVDYSFKLLICMLFFLPAYGVMLNVLLKYFARQTGQPVLATER
FT                   "
     atgttttcgt ttactgtcca acagcggatg accgcgttgg tatggctatc gctattccat        60
     attgtcatca ttacctccag taactacctg gtgcaattgc cgatcgctat cttcggcttt       120
     cataccactt ggggggcttt tacctttcca tttatcttct tagccactga cctgaccgtg       180
     cgaatttttg gtgccccttt ggcgcgccgg attattcttt ccgtgatggt gcccgcgttg       240
     ttgatttcgt atctgatatc agcactgttt tatcagggaa gctggcaggg gttccccgca       300
     ttaaccagtt ttaatctggt ggttgctcgt atcgccgtcg ccagttttat ggcctatgtt       360
     cttggccaaa ttctggatgt tcaggtgttt aaccgcctac gtcagcgtaa tgcctggtgg       420
     gttgcaccta ctgcggccat gttctttggc aatatcagtg acaccatggc attcttcttc       480
     attgctttct atcgcagtag tgacccgttt atggcagcac actgggtgga aattgcgtta       540
     gtcgattaca gctttaagct gttaatttgc atgttgttct tcctgccagc ttatggcgtg       600
     atgctgaatg tgttgctgaa gtactttgcc cggcagacgg gtcagccagt gctggcaact       660
     gaacgatag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page