(data stored in ACNUC9543 zone)

EMBL: CP000308.PE204

CP000308.PE204       Location/Qualifiers
FT   CDS_pept        243590..243910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12173"
FT                   /db_xref="InterPro:IPR014949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTM9"
FT                   /protein_id="ABG12173.1"
FT                   /translation="MANEQLLYRIQFINNGKNYQLYVREIGSSSLFGFIEIADFVFDSQ
FT                   STLLVDPSTEKLKTEFSGVNRSYIPLHAVIRIDSVTEKGSARISELGNNVMNFPYLPGN
FT                   KP"
     atggcgaatg aacaactgct ttatcgtatt cagtttataa ataatggtaa aaattatcag        60
     ctttatgtcc gtgaaatcgg ttctagctcg ttatttggat ttattgaaat tgctgatttt       120
     gtctttgata gccaatcaac attgttagtt gatccctcga cagagaaatt gaaaactgaa       180
     ttttctggtg tcaaccgtag ctatattcct ctacatgcgg tcattcgtat tgatagtgtc       240
     accgagaaag gtagcgcccg gatatctgag cttggcaaca atgtgatgaa tttcccctat       300
     ttaccgggta ataaacccta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page