(data stored in ACNUC9543 zone)

EMBL: CP000308.PE205

CP000308.PE205       Location/Qualifiers
FT   CDS_pept        244122..244541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0205"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12174"
FT                   /db_xref="InterPro:IPR019635"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNM1"
FT                   /protein_id="ABG12174.1"
FT                   /translation="MSKLPLLFIAVVVLIVVLATRQYWQKKQQDAENDRAPVRSVQVEV
FT                   VDKREVLAPNRRSRQREEIVAEEKRYEVYFRPLSSGIEIKNSLGLSGGNEIKSGSEIKM
FT                   VLPQQEYNRIEQGAQGILRLQGTRYIGFIPDAPHP"
     atgagcaaac tccctttatt atttattgcc gttgtggtgc tgatcgtcgt gctggcaacc        60
     cgccagtatt ggcagaaaaa acagcaggat gcagaaaatg atcgcgcacc ggtgcgtagt       120
     gtgcaagttg aggtcgttga taaacgtgaa gtccttgccc ccaatcgccg atcaaggcag       180
     cgcgaggaga tcgtggctga agagaaacgc tatgaagttt atttccgtcc actgtccagt       240
     ggcatagaaa taaagaacag cctcggactc tctggaggca atgaaataaa gagcggcagt       300
     gaaattaaaa tggtattgcc ccagcaggaa tataaccgca ttgagcaagg tgcacaggga       360
     atattgcgtt tacaaggcac gcgctatatc ggttttatcc cggatgcccc gcatccttga       420
//

If you have problems or comments...

PBIL Back to PBIL home page