(data stored in ACNUC9543 zone)

EMBL: CP000308.PE209

CP000308.PE209       Location/Qualifiers
FT   CDS_pept        247556..248224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0209"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12178"
FT                   /db_xref="GOA:A0A0E1NP42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NP42"
FT                   /protein_id="ABG12178.1"
FT                   /translation="MIRFEQVSKAYLGGRQALQGVDFHLRPAEMAFLTGHSGAGKSTLL
FT                   KLICGIERPSAGHIWFGGHDISRLKNREVPFLRRQIGMIFQDHHLLLDRTVYDNVAMPL
FT                   IIAGASSEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADE
FT                   PTGNLDDALSEGILRLFEEFNRVGVTVLMATHDTSLIARRRYPILTLSQGRMSGAHHGE
FT                   "
     atgattcgct ttgaacaggt cagtaaagct tatctggggg gacggcaggc gctgcagggg        60
     gtcgattttc atctgcgtcc tgcggaaatg gcgttcctga ccggccattc tggtgcaggg       120
     aaaagtactc tgctgaaact gatttgtggt atcgaacgcc ccagtgcggg tcatatctgg       180
     tttggtggtc atgatatcag ccgtctgaaa aaccgtgagg tgcccttttt gcgccgccaa       240
     atcgggatga tctttcaaga tcaccacctc ctgctggaca gaacggttta cgacaacgtc       300
     gctatgccac tgattatcgc cggtgcgagt agcgaagata ttcgtcgtag ggtctcggct       360
     gcactggata aagtcggcct attggataag gcgaaaaatt tccccattca gctatccggt       420
     ggtgaacaac aacgcgtagg gattgcccgc gccgtagtga ataaacccgc ggtattgctg       480
     gccgatgaac cgaccggtaa cctggatgat gccttatcag aaggtatttt gcgtctgttt       540
     gaagagttta accgcgtggg ggttaccgtc ttgatggcca cccacgatac gtcgttgatt       600
     gcccggcggc gttacccgat cctgacgttg agtcaggggc ggatgtcagg agcacaccat       660
     ggcgaataa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page