(data stored in ACNUC9543 zone)

EMBL: CP000308.PE219

CP000308.PE219       Location/Qualifiers
FT   CDS_pept        257528..258295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0219"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12188"
FT                   /db_xref="GOA:A0A0E1NNW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNW4"
FT                   /protein_id="ABG12188.1"
FT                   /translation="MNGQPLLTVEGLSMRFGGLLAVNNVGLTLNQGEIVSLIGPNGAGK
FT                   TTIFNCLTGFYRPTGGTIKLRERHLEGLPGQMIARMGVIRTFQHVRLFREMTVIENLLV
FT                   AQHQHLKSGIFAGLLKTPGFRRAEADALARAATWLERVGLLALANRQAGNLAYGQQRRL
FT                   EIARCMVTRPELLMLDEPAAGLNPKETDELNQLIMELRDQHQVSVLLIEHDMKLVMGIS
FT                   DRIYVVNQGTPLAQGLPAEIRNNPDVIRAYLGE"
     atgaatgggc aacctttgtt aacagtcgaa gggctgtcga tgcgttttgg tggattactg        60
     gcggtcaata acgttggctt gacgttgaat cagggggaga ttgtctcgct gattggcccg       120
     aacggggccg gtaaaaccac gatctttaac tgcctgaccg ggttttatcg cccgacaggc       180
     ggcaccatta agctacgtga acgccatctt gaaggattac cgggccagat gattgcccgc       240
     atgggggtga ttcggacttt ccaacatgtg cgtttgtttc gcgaaatgac ggttatcgag       300
     aacttgctgg tggcgcaaca tcagcacctc aagagcggga tttttgcggg tttgctgaaa       360
     acccccggtt ttcgccgggc ggaagcggat gcactggcgc gagcggcaac ttggctggag       420
     cgggtagggc tattagcgct ggcgaaccgt caggcaggga atttagccta cggtcagcaa       480
     cgacggctgg aaatcgcccg ctgcatggtg acacgccccg agttattgat gctggatgaa       540
     cccgctgcag gtctgaaccc gaaagagacc gatgaattga atcagctgat tatggagcta       600
     cgtgatcaac atcaggtctc ggtactgttg attgagcatg atatgaagct ggtgatgggt       660
     atttctgacc gaatttatgt ggtgaatcag ggaacgccgt tggcgcaagg cctacccgca       720
     gaaatccgta acaatccgga tgtgatccga gcctatttgg gtgaataa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page