(data stored in ACNUC9543 zone)

EMBL: CP000308.PE220

CP000308.PE220       Location/Qualifiers
FT   CDS_pept        258310..259041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0220"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12189"
FT                   /db_xref="GOA:A0A0H2Y4U9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4U9"
FT                   /protein_id="ABG12189.1"
FT                   /translation="MESGRGINNNMLSFNQVSAHYGKIQALHQVSLHIQQGEIVTLIGA
FT                   NGAGKTTLLGTLCGEPRATEGNIVFGEQDITHWQTARIMREAIAIVPEGRRVFSRMTVE
FT                   ENLAMGGFFADRQQYQQRIERVYDLFPRLFERRIQRAGTMSGGEQQMLAIGRALMSQPK
FT                   LLLLDEPSLGLAPIIILQIFDTIQQLREEGMTIFLVEQNANQALKLADRGYVLENGRIV
FT                   LEDTGAALLANEAVRSAYLGG"
     atggaaagcg ggcgaggcat aaacaataac atgttgtcat ttaatcaagt ttcagcccat        60
     tacggcaaaa ttcaggcatt gcaccaggtc agtttacata ttcagcaagg cgaaattgtg       120
     acactgattg gggccaatgg tgcgggcaaa accacattat tggggacctt atgtggtgag       180
     cctcgagcca ctgagggcaa tattgtcttt ggtgaacaag atatcaccca ctggcagact       240
     gcacggatta tgcgcgaagc tatcgcgatt gtccctgagg gccggcgggt tttctctcgt       300
     atgacagtag aagaaaatct ggcaatgggc ggtttttttg ctgatcgtca gcaatatcag       360
     cagcggatcg aacgggttta tgatttgttc ccacggctgt tcgagcggcg tatccagcgg       420
     gcaggaacca tgtctggtgg tgaacaacag atgttggcaa taggccgggc gttgatgagc       480
     cagcccaaat tgctgctact ggatgaaccg tcactgggat tagcgccaat tatcattttg       540
     caaatattcg ataccattca acaactgcgg gaagaaggaa tgaccatctt tttagtggag       600
     cagaatgcga atcaggccct gaaattggct gaccgtggtt atgtgttgga gaatggccgt       660
     attgttttgg aagataccgg cgcagctttg cttgcgaatg aagcggtgcg gtcagcttat       720
     cttggtggct aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page