(data stored in ACNUC9543 zone)

EMBL: CP000308.PE223

CP000308.PE223       Location/Qualifiers
FT   CDS_pept        complement(261183..261701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12192"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX55"
FT                   /protein_id="ABG12192.1"
FT                   /translation="MNTIKMAITLLLLSWHTCWAATPLGDIDVKLEVTAQPRIEIEKPH
FT                   GGWYDNIKLHNSPENHAVYEVEVPVAVKLRRQEGYQISIKNPLILTRQSDAFSAIEQTF
FT                   SPAEVRWGNNRTNLRLLSAVPESFSVPPQATRHTTTDYVLQISAKAPAGDNTAGKYHGQ
FT                   LTLVFEVNS"
     atgaatacca taaaaatggc catcacattg ctattgctct catggcacac ctgctgggcc        60
     gcaacgccat tgggggatat cgacgtcaaa ttagaggtaa cagcccaacc cagaatcgaa       120
     attgaaaaac cgcatggtgg ctggtacgac aatatcaagc tgcacaatag cccagagaac       180
     catgccgttt atgaggtaga agtcccggta gccgtcaaac tccggcggca agaggggtat       240
     caaatctcaa ttaaaaaccc gctaatactc acccgccaat cagatgcttt cagcgcaata       300
     gaacagacat tctcaccggc ggaagtgcgt tggggaaata accgcaccaa tttacgttta       360
     ctgtcagcgg taccggagtc ctttagcgtc cccccacagg caacccgcca caccaccacc       420
     gattatgtct tacagatatc cgcaaaagcc cccgctgggg acaatactgc ggggaaatat       480
     cacgggcaac tgacattggt attcgaagtt aatagttaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page