(data stored in ACNUC9543 zone)

EMBL: CP000308.PE228

CP000308.PE228       Location/Qualifiers
FT   CDS_pept        266732..268051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0228"
FT                   /product="glycerol-3-phosphate-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12197"
FT                   /db_xref="GOA:Q1CBH5"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBH5"
FT                   /protein_id="ABG12197.1"
FT                   /translation="MFNNSIHKVSICIALTLTFSANAMAVTEIPFWHSMEGELGKEVDS
FT                   IADRFNQSQPDYKIVPVYKGNYEQSLAAGIAAFRSGKAPAILQVYEVGTATMMASKAIK
FT                   PVYQVFKDANIDFDESVFVPTVAGYYTDSKTGRLLSQPFNSSTPVLYYNKEAFKKAGLD
FT                   PEQPPKTWQELAADTAKLRAAGSSCGYASGWQGWIQIENFSAWHGQPIASRNNGFDGTD
FT                   AVLEFNKPLQVKHIQLLSDMNKKGDFTYFGRKDESTSKFYNGDCAITTASSGSLASIRH
FT                   YAKFNFGVGMMPYDADAKNAPQNAIIGGASLWVMDGKDKETYKGVAEFLQYLVKPEIAA
FT                   EWHQKTGYLPITTAAYELTKQQGFYEQNPGADVATRQMLNKPPLPYTKGLRLGNMPQIR
FT                   TVVDEELEAVWTAKKTPQAALDNSVKRGDVLLRRFEQANK"
     atgtttaata attccattca taaagtgtcg atctgtatcg cgctaacact tacgtttagt        60
     gccaatgcga tggcagtgac tgaaattcct ttttggcatt cgatggaagg agaattaggt       120
     aaagaagtcg attcaattgc ggatcgtttt aaccagtcgc agcccgatta taaaattgtt       180
     cctgtttata aaggtaatta cgagcagagt ttggccgcag gtattgcggc attccgttca       240
     ggtaaggcac cggctatttt acaagtctat gaagtcggta ctgccaccat gatggccagt       300
     aaggcgatca aaccggttta ccaagtcttc aaagatgcca atattgattt tgatgagtcc       360
     gtcttcgttc caacagtggc aggctattac actgattcta aaactgggcg tttattgtct       420
     cagccgttta acagctcgac ccccgtgctg tattacaaca aagaggcttt caaaaaagcg       480
     ggcttggacc cagaacaacc gccaaaaaca tggcaagaac tggcagcaga taccgctaag       540
     ctacgcgctg cgggttctag ttgcggttat gccagcggtt ggcaagggtg gattcaaatt       600
     gagaacttca gtgcttggca tggtcagccg atagccagcc gcaacaatgg ttttgacggc       660
     actgatgcgg tattggaatt caataaaccc ttgcaggtca aacatatcca attgctgtcg       720
     gatatgaata aaaaaggtga tttcacctat tttggccgta aagatgaatc tacgtccaag       780
     ttctataacg gtgattgcgc tattaccacc gcctcttctg gctccctcgc cagtatccgc       840
     cattatgcca agtttaattt cggtgttggc atgatgccgt atgacgcaga tgcaaaaaat       900
     gcgccgcaaa acgccattat tggtggtgct agcctgtggg tgatggatgg caaagataaa       960
     gagacttaca agggtgtcgc agagttcttg caatatttgg tcaaaccaga gattgccgct      1020
     gaatggcatc agaagacggg ttatctgccc atcacgacgg cggcatatga actaacgaaa      1080
     caacaaggtt tttatgagca gaacccaggc gctgatgtag cgacccgcca gatgctgaat      1140
     aaaccgccat tgccttatac caaaggcctg cgtctcggca atatgccgca gatccgtacc      1200
     gtggttgatg aagagctgga agctgtatgg accgctaaga agacgcctca ggcggcattg      1260
     gataactctg tgaagcgggg tgatgtgtta ctgcgtcgtt ttgaacaagc caataaataa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page