(data stored in ACNUC9543 zone)

EMBL: CP000308.PE231

CP000308.PE231       Location/Qualifiers
FT   CDS_pept        270085..271158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0231"
FT                   /product="sn-glycerol-3-phosphate transport, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12200"
FT                   /db_xref="GOA:Q1CBH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBH2"
FT                   /protein_id="ABG12200.1"
FT                   /translation="MACLKLQAVTKSYDGVTPVIKQIDLDVADGEFIVMVGPSGCGKST
FT                   LLRMVAGLERTTTGDIYIGDQRVTDLEPKDRGIAMVFQNYVLYPHMNVFDNMAYGLKIR
FT                   GFGKEQIRQRVDEAARILELQPLLKRKPRELSGGQRQRVAMGRAIVREPAVFLFDEPLS
FT                   NLDAKLRVQMRLELQQLHRRLKTTSLYVTHDQVEAMTLAQRVIVMNKGVAEQIGTPSEV
FT                   YKRPASLFVASFIGSPAMNLLDGTVSPDGRTFILSDGLTLPLEIPQPQWGGRRLTLGIR
FT                   PEHIQQTTSAQGVPMNLLTLELLGADNLAHGLWGGQSIIARLSHEEMPVAGSTLHLYLP
FT                   PAALHFFDTDSGLRIEP"
     atggcatgtt taaaattaca ggcagtaacc aaatcttatg acggcgtgac gccagtgatt        60
     aagcagattg atttggatgt cgccgatggc gaattcatcg tgatggtcgg tccgtccggg       120
     tgtggtaaat caacgctgtt acgcatggtc gcggggttag aacgcacgac cactggggat       180
     atctatatcg gggatcagcg ggtaaccgat ctggaaccta aagaccgtgg tatcgcgatg       240
     gtatttcaga attacgtgct ttatccccat atgaacgtat tcgataacat ggcttatggc       300
     ctaaaaatcc ggggttttgg caaagaacag atccgccaac gggtggatga agcggcacgt       360
     attctggagt tgcagccgct actgaaacgc aaaccgcgtg agttatccgg tggtcagcgg       420
     cagcgggtag cgatggggcg tgccattgtg cgcgagcccg cagttttctt atttgatgag       480
     ccgctctcta atctggatgc caagttacgg gtgcagatgc gccttgaact gcaacaactg       540
     caccgccgcc tgaaaaccac tagcttgtat gtcacacatg atcaggttga ggccatgaca       600
     ttggcacagc gggtgattgt gatgaacaaa ggggttgccg agcaaatcgg tacccccagc       660
     gaggtttata aacggcctgc gtcactgttt gtcgccagtt ttatcggctc gcccgcgatg       720
     aatttattag acggtacggt cagcccagat gggcgcacgt ttattttatc cgatggtctg       780
     actctgccac tggagatccc tcagccacaa tgggggggcc ggcgcttgac tctaggtatt       840
     cgcccggagc atattcagca gacaacctca gcgcagggtg tgccgatgaa cctgctaacg       900
     ctggaattat taggcgcaga taatctggcg cacggcctgt ggggcgggca aagtatcatt       960
     gctcgcttat cccatgaaga aatgccagtg gcaggcagta cattgcattt atatttaccg      1020
     ccagcagcgc tgcacttctt tgataccgat agcggactac ggatagaacc atga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page