(data stored in ACNUC9543 zone)

EMBL: CP000308.PE233

CP000308.PE233       Location/Qualifiers
FT   CDS_pept        272005..272931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0233"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12202"
FT                   /db_xref="GOA:A0A0E1NM42"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM42"
FT                   /protein_id="ABG12202.1"
FT                   /translation="MPAFVVSLWHQIVLSSPLFVLLALGYALVRFGKWPSTITDGLTRF
FT                   VFSLALPAMLFRMMCDFSERPAVDARLLIAFFGSCLVVFIIGRVIAKRVFHLDGVSGSV
FT                   FALGGIFSNNVMLGLPIATIMLGEKSIPAVALVLVFNGLILWTLVTISVEWARNGSPTM
FT                   AGFVKTTRSVLTNPLIIGIISGTLFSLTGLHLPVFIDQPVSMLGQVAPPLSLIVLGMGL
FT                   AEYRVTEGWQISTAICFLKLIVQPMVIWALAWAMDLPALETQVVVLLGSMATGVNVYLM
FT                   SRQFNVLTGPAAASLVIQRYWPPSPRH"
     atgcccgcct ttgttgtttc gctctggcac caaatcgttt tgtcttcacc gttatttgtt        60
     ttgctcgcac tgggatatgc tctggtgcga ttcggtaagt ggccatcgac cattacggat       120
     ggtctgactc gctttgtttt ctccctcgcg ctgcctgcca tgctatttcg catgatgtgt       180
     gacttctccg aacgcccggc ggttgatgct cgcctattga ttgctttttt tggcagttgt       240
     ctggtggtgt ttatcattgg gcgggttatc gccaaacggg tgtttcatct ggatggcgtt       300
     tctggctcag tctttgccct cggtgggatc ttttccaata acgtgatgct agggctacct       360
     attgccacca tcatgctggg ggagaaatct atccctgcgg tggccttggt gctggtattt       420
     aacgggctga tcttgtggac gctggtcacc atctcggtgg agtgggcacg aaatggttca       480
     ccgacgatgg ctggttttgt gaaaacgacc cgtagtgtgc tgactaaccc actcattatc       540
     gggattattt ccggcacctt attcagcctg acggggttac atttaccggt gtttattgac       600
     caaccggtca gtatgttagg gcaggttgca cctccgctct cattgattgt cttgggtatg       660
     gggctggcag aataccgcgt gaccgaaggt tggcagatta gtaccgctat ctgctttctc       720
     aagttgattg tgcagccgat ggtgatttgg gcgctggcat gggcgatgga tctgcccgcg       780
     ctagaaactc aagtcgtggt gttgctgggg tcgatggcaa cgggggtgaa tgtttatctg       840
     atgtcacgtc agtttaatgt cctcaccggc cccgccgccg ccagcctggt gattcaacgg       900
     tactggccgc cgtcaccacg ccactga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page