(data stored in ACNUC9543 zone)

EMBL: CP000308.PE235

CP000308.PE235       Location/Qualifiers
FT   CDS_pept        complement(274100..275053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0235"
FT                   /product="lysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12204"
FT                   /db_xref="GOA:A0A0E1NSW8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSW8"
FT                   /protein_id="ABG12204.1"
FT                   /translation="MIELKHLRTLQALRNTGSLAAAATQLHQTQSALSHQFSDLEQRLG
FT                   FRLFVRKSQPLRFTTQGEILLQLAEQVLPQIKQALQTCNEPHQTALRIAIECHSCIQWL
FT                   TPALDNFHKHWPQVTMDFKSGVTFDPQPALQQGELDLVLTSDILPRSGLHYSPMFDFEV
FT                   RLVLAPDHPLANKDRIEPEDLAPEVLMIYPVQRQRLDVWRHFLQPAGVSPSSKNVDNTL
FT                   LLIQMVSARMGIAALPHWVVESFERQGLVVTKTLGEGLWSRLYAAVRDGEQRQPVTEAF
FT                   IRSARQHACDHLPFVKDAVRSNAGVPTAKPLSPQLQ"
     atgatcgaac tgaaacactt acgcaccctg caagctttgc gtaatactgg ctcgctggca        60
     gcggcggcaa cgcaacttca tcagacccaa tcggccctgt cccatcaatt tagtgatctg       120
     gaacagcgtc tgggatttcg cctgtttgta cgcaaaagcc aaccgctgcg tttcacgacg       180
     cagggggaga ttttgttaca attggcagag caagtgctgc cacaaattaa acaggcactg       240
     caaacctgca atgagccaca ccaaacggcg ttacgcatcg caatcgagtg ccacagctgc       300
     attcagtggc tgacacccgc gttggataat ttccataagc actggccgca agtgactatg       360
     gacttcaaat caggcgtcac ttttgacccg caacccgcat tacagcaagg ggaactggat       420
     ctggtgctga catcggatat tttgccgcgc agtggcctgc actattcacc gatgtttgat       480
     tttgaagtgc gcctggtatt ggctccggac catccgttag ccaataaaga ccgcattgaa       540
     ccagaagatt tagcgccaga agtattgatg atttatccgg tgcagcgaca gcggctggat       600
     gtttggcggc acttcctgca acccgcaggc gtcagcccat cgtcgaaaaa tgtggataac       660
     acattgctgc tgatccagat ggtatcagca cggatgggta tcgcggcatt gcctcactgg       720
     gtggtggaga gctttgagcg ccaaggattg gttgtcacta agacgctggg agaagggttg       780
     tggagccggt tatacgctgc cgtccgtgat ggagaacagc gccaaccagt cactgaagcg       840
     tttattcgtt ctgctcgtca gcacgcttgc gatcatttgc cgtttgtaaa ggatgcggtg       900
     cgatccaacg ccggtgtacc cacagcgaag ccattatcac cgcagctcca atga             954
//

If you have problems or comments...

PBIL Back to PBIL home page