(data stored in ACNUC9543 zone)

EMBL: CP000308.PE239

CP000308.PE239       Location/Qualifiers
FT   CDS_pept        279672..280502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12208"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3L3"
FT                   /protein_id="ABG12208.1"
FT                   /translation="MTMTTFSHPSLIPLDGGINFRDLGGNLAADGRRIKPGLLFRSGSL
FT                   DRLSTNDCDFLSHSNVTQIIDYRDADEVQAKPDVLWPGAHYHNIPANPLSSEVNANLEK
FT                   LTNETLATFDVRAFMFELYHRLPFNSLAYQQLVNLLQNCASTDPVASSVVHSGDVVHRG
FT                   IVQHCAVGKDRTGVGAALVLFALGADESTVLEDYLLTETTLKPFREHMLAELALKLNDQ
FT                   ALAQFTFVLSAREEFIQTTLRSIHERYGSRERWLKHEFGLGSIEREKLQSYFLE"
     atgacgatga cgaccttctc tcatccctcc ctgatcccac tggatggcgg tattaacttt        60
     cgtgatctcg ggggtaacct tgccgctgat ggccggcgga taaagcccgg cttgttattt       120
     cgttccggtt cgcttgatcg cttgagtacc aacgattgtg attttctcag tcacagtaac       180
     gttacccaaa ttattgatta ccgtgatgcc gatgaagtac aggctaagcc agatgtttta       240
     tggccgggtg cccactatca caatataccg gccaacccgc tcagtagtga ggtgaatgcc       300
     aatctggaaa aattgactaa cgagacatta gccacatttg atgtccgtgc ctttatgttc       360
     gagctttatc accgcttacc ttttaatagc ttggcttatc agcaattggt caatttattg       420
     caaaattgtg catcaacgga ccctgtcgct agcagcgttg tgcatagtgg cgatgtggta       480
     catagaggta ttgtacagca ctgtgcggtt ggaaaagacc gcacgggtgt aggtgctgcg       540
     ttggtactgt ttgctttggg ggctgatgaa tctactgtgc tggaagatta tctgttgacg       600
     gaaaccaccc tgaagccttt tcgtgagcat atgctggctg aattggcact aaaactgaat       660
     gatcaggctc tggcgcaatt tacatttgtt ctctctgcca gagaagagtt tattcaaact       720
     acgctgcgga gcattcatga gcgttatgga agcagggagc gttggttaaa gcatgagttc       780
     ggtcttggca gtattgagcg tgaaaaacta cagtcttatt ttttagagta a                831
//

If you have problems or comments...

PBIL Back to PBIL home page