(data stored in ACNUC9543 zone)

EMBL: CP000308.PE242

CP000308.PE242       Location/Qualifiers
FT   CDS_pept        283687..285192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0242"
FT                   /product="putative DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12211"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVM4"
FT                   /protein_id="ABG12211.1"
FT                   /translation="MDISLFYGLGGCLVGGLIGWLIASLSQQRTKAQQDIERRLLEQAL
FT                   QQAQQSIATLQMTQQRNEQQLRQSELEQRNLHSQLAANSEKLQQLAHWRNECEQLNQEL
FT                   RAQREINSAQEAELREVTIRLEETRLATEEKQRLLLNSEQRLTTQFENLANRIFEQTGR
FT                   RADEQNKQSLDRLLLPLREQLDGFRRQVQDSFGQEARERHTLTHEIRNLQQLNAQMARE
FT                   ALNLTKALKGDNKTQGNWGEVVLAKVLEASGLREGHEYQTQVSVKIDQTSRMQPDVIVR
FT                   LPQGKDVVIDAKMSLVAYERYFNSEDDAEREVALNEHLSSLRGHIRMLGRKDYQQLPGL
FT                   RSLDYVLMFIPVEPAFLVAIDRQPELINEALQHNIMLVSPTTLLVALRTITNLWRYEHQ
FT                   SQNAQRIAERAARLYDKVRLFVDDMASLGQSLDKAQLSYHQAMNKLSQGRGNLVGQVES
FT                   FRTLGVEVKRPISPLLAEKACAEHQPEGDLALSDDAESGAFPE"
     gtggatatca gtttatttta tgggctgggt ggctgtttgg tcggggggct gatcgggtgg        60
     ctaattgcca gtttgtccca gcagcgaaca aaagcacagc aagatattga acggcgatta       120
     ctggagcagg cattacagca ggcacaacag agtattgcta cattgcagat gactcaacaa       180
     cgtaatgagc aacagttacg gcaaagtgag ttggaacaac gtaatttgca tagccaatta       240
     gcggcaaata gcgaaaaatt acagcagctt gctcattggc gtaatgaatg tgaacagctt       300
     aatcaagaat tgcgggctca aagggaaatc aatagtgccc aagaagcaga attacgtgaa       360
     gtcaccatcc gcttagaaga aactcgctta gccacagaag aaaagcagcg tttattactt       420
     aatagtgaac agcgactgac cactcagttt gagaatttgg caaaccgcat ctttgagcaa       480
     acggggcgtc gggctgatga acagaataag caaagcttag atcgcctgct attaccttta       540
     cgtgaacagc ttgatggctt tcgtcgtcag gttcaggata gctttgggca agaagctcgg       600
     gagcgtcata ctctgactca cgaaattcgg aacctgcaac aattgaatgc ccagatggcg       660
     cgagaggcat tgaatctgac caaggctttg aaaggggata ataaaacaca gggtaactgg       720
     ggggaagtcg ttctggccaa agtgcttgaa gcctcagggt tacgtgaggg gcatgaatat       780
     caaacacagg ttagcgttaa aattgaccaa accagtcgta tgcagccgga tgtgattgtt       840
     cgattacccc aaggcaaaga tgtcgttatt gacgctaaaa tgtcattggt tgcctatgaa       900
     cgttatttta atagcgaaga tgatgctgaa cgtgaggttg cgttgaatga acatttatca       960
     tcattacgtg gccatatcag gatgctgggg cgtaaagatt accagcaact ccccggttta      1020
     cgctccctcg attatgtgtt gatgtttatc ccggtagaac ctgcattttt ggtggctatt      1080
     gaccgccagc ctgagttgat caacgaagca ctacaacaca atatcatgtt ggtcagccct      1140
     accacattac tagtggcttt gcgcactatc accaatttgt ggcgctacga gcatcaaagc      1200
     caaaatgcgc aacgtattgc tgaaagagcc gccagacttt atgacaaagt acgcttgttt      1260
     gttgatgata tggcgtcttt ggggcaaagc ctcgataaag cacagctaag ctatcaccag      1320
     gcaatgaata aactgtccca gggccgtggt aacctagttg ggcaagtaga gagttttcgc      1380
     actctagggg tcgaggtaaa gcggcctatt agcccattac tggcagaaaa agcctgcgcg      1440
     gagcatcaac ctgagggtga tttagcgcta tccgatgacg cagaatcagg ggcatttcca      1500
     gagtaa                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page