(data stored in ACNUC9543 zone)

EMBL: CP000308.PE244

CP000308.PE244       Location/Qualifiers
FT   CDS_pept        286053..286703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12213"
FT                   /db_xref="GOA:A0A0E1NLQ5"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLQ5"
FT                   /protein_id="ABG12213.1"
FT                   /translation="MSLRTLMLKPFLLKPRLLTPLITAALETVLNGVLFNDKSLKAARS
FT                   RLVGKVLRIELREINFPLLFVFSERQVDVLSQWDDAADCLVKTDVAVLARLRDRQQLSP
FT                   LMRTGELVVEGDIQVVQQLVALLDLAEWDLAEWLAPYVGDVAAESLGQAIHKSSGFLSR
FT                   QLRQQQHYLAEAITEEWRMAPNLLEVMWFHEEVDATARATEALSSRLATMETK"
     atgtcactaa gaacactaat gctaaagccc tttttattaa aaccaaggtt actgacaccc        60
     ctaataaccg cagccttaga aacggttctc aatggtgtgt tgtttaatga taaaagccta       120
     aaagctgccc gttcacgttt agtgggcaaa gtgttacgta ttgaattacg tgaaataaat       180
     ttcccattgc tgttcgtgtt tagtgagcgt caagtcgatg tcttaagcca gtgggatgat       240
     gctgcggact gcctagttaa aacggatgtc gctgtactgg caagattacg tgaccgccag       300
     caactttcgc ctttaatgcg cacgggtgaa ttggtggttg aaggtgacat tcaagtagtc       360
     cagcaacttg tcgcgttatt agatcttgct gagtgggatc ttgcggaatg gttggcacct       420
     tatgtgggtg atgttgctgc tgaaagtctg gggcaagcta ttcacaaaag tagcggtttt       480
     cttagtaggc aattacggca acagcagcat tatttggctg aagctatcac cgaggagtgg       540
     agaatggctc ccaacctgct ggaagtcatg tggtttcatg aagaagtcga tgcaaccgct       600
     cgtgcaaccg aagctttgag ttccagattg gcaactatgg agacaaaata a                651
//

If you have problems or comments...

PBIL Back to PBIL home page