(data stored in ACNUC9543 zone)

EMBL: CP000308.PE247

CP000308.PE247       Location/Qualifiers
FT   CDS_pept        288784..289446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0247"
FT                   /product="Sec-independent protein translocase TatB"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12216"
FT                   /db_xref="GOA:Q1CBF6"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBF6"
FT                   /protein_id="ABG12216.1"
FT                   /translation="MFDIGFSELLLVLVIGLVVLGPERLPVAVRTVSGWIRTLRSLAAT
FT                   VQNELAQELKLQELQDSLKKVEQAGLQNLTPELKASMDELKEAAEALKRSYHVDAGSEA
FT                   PHTIHNPLVTEPEAIHDGVTPAEPATQVSALAQAPNILEAGTASVVDSVVEAAPVTTVK
FT                   SVVQGEVLVKSTPVQEVGLADVMDKPVTKQQIDTIDSHGTDLSSAGPSRIHQPGGDQ"
     gtgttcgata tcgggtttag tgaactgcta ctggtccttg taattggtct ggtcgtactt        60
     gggccggagc gattacctgt cgccgtaagg actgtttctg gctggattcg tacattgcgt       120
     tcgcttgcgg ccactgtaca aaacgaactg gcacaagagc taaaactaca agagttacaa       180
     gacagcctga aaaaagtaga gcaggccggc ttacaaaatc tgacgcctga attgaaggcg       240
     tcgatggatg aactcaaaga ggccgcagag gcgctaaaac gttcttatca tgttgatgct       300
     ggatcagaag ctccacatac gatccataac ccattggtga cagagccgga agcgatccac       360
     gacggtgtta cgccagcgga gccagcaaca caggtttccg cattggcaca ggcccctaat       420
     atacttgagg cagggacagc gtcagtggtt gactctgtag tcgaagctgc acctgttact       480
     accgtgaaat cggtggttca gggggaggta ttggttaagt cgactccagt acaagaagta       540
     gggttggcag atgttatgga taaacccgta accaagcagc aaatcgatac aatcgattcc       600
     catggcacgg atttatccag tgctggccca tctcgtattc accaacctgg cggcgatcag       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page