(data stored in ACNUC9543 zone)

EMBL: CP000308.PE252

CP000308.PE252       Location/Qualifiers
FT   CDS_pept        292901..293485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12221"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVS7"
FT                   /protein_id="ABG12221.1"
FT                   /translation="MQRGCCFLRSTTTAGVALIVAMTLSVSAWAISEQAKSEQATTVPN
FT                   NDIVCHVAHLNARFDDKEGLFEGASQSGTLLILRNISARACQVNAMPVISFEGAVGQQL
FT                   AVFRKVPRGMRQEPVLSPVTVAAGAEVAVQLRWVASDAFDGNNCVTPEKVVVTLLGGTL
FT                   RLPFGRQMCAASGDTEFFSQAPVGPATNEVQ"
     atgcaaagag gctgctgttt tctccgtagt acaactaccg ctggagtggc tttgatcgtt        60
     gccatgacgc tatcggtatc ggcatgggca atttcagaac aggcaaagtc agaacaggcc       120
     acgaccgtac caaataatga tatcgtctgt catgtggctc acctcaacgc ccgttttgac       180
     gataaagagg ggctattcga aggtgcatca caaagcggta ctttgctgat attacgtaat       240
     attagcgctc gagcctgcca ggttaatgca atgccagtga tcagtttcga aggcgcagtt       300
     ggccagcagt tggccgtctt tcgcaaagta ccgcgtggga tgcggcagga gccggtactc       360
     tcacccgtca ctgttgcggc gggagctgaa gtcgcggtgc aattgcgttg ggtggccagt       420
     gacgcgttcg atgggaataa ctgtgtaaca cctgagaaag tggtggtgac cctgctaggg       480
     gggacattgc gtttaccttt cggccgacag atgtgtgcgg catctggtga tactgaattc       540
     ttcagtcagg caccagtagg cccagcgacc aatgaggtgc aatga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page