(data stored in ACNUC9543 zone)

EMBL: CP000308.PE257

CP000308.PE257       Location/Qualifiers
FT   CDS_pept        complement(297408..298154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0257"
FT                   /product="cell division protein FtsN"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12226"
FT                   /db_xref="GOA:A0A0E1NPB1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPB1"
FT                   /protein_id="ABG12226.1"
FT                   /translation="MALAVALLVVFVGGLYFITHNKPGELPLLPNHDPRTGNGLPPKPE
FT                   ERWRYIKELENRQIGVPMPTEPSAGGEVNAKTELTNEQRQLLEQMQADMRQQPTQLSEV
FT                   PYNQGMQQVPRSAVTIKPPATSVQPQPVTPPRQTTIPVQPQAPAPVRTPPAAPVTQAVT
FT                   PPKVEKEKEKTQRWMVQCGSFKAVDQAESIRAQLAFAGIESRITSGGGWNRVVLGPYNS
FT                   KAAADKALQRLQGAGQSGCIPLSVGG"
     atggcactgg ctgtcgcgct attagtggtg tttgttggcg gcctctattt tatcacccac        60
     aataaaccgg gtgagcttcc gctattgcca aatcatgacc cacgtaccgg gaatgggcta       120
     ccgccaaaac cggaagaacg ctggcgttat attaaagaat tggaaaatcg tcagattggc       180
     gtacccatgc caacagaacc ctctgcaggg ggtgaagtaa acgccaaaac agagttgacc       240
     aatgaacaac gtcagttact ggagcagatg caggcagata tgcgtcaaca accgacgcaa       300
     ctttctgagg ttccctataa ccaaggtatg cagcaggtac cacgttcagc ggtaaccatc       360
     aaaccaccgg ccaccagtgt acagccgcaa ccggtaactc cgccgcgtca aaccactatt       420
     cctgtacaac ctcaagcacc ggcccccgtg cgtacaccgc ccgccgcgcc agtgactcag       480
     gccgttacgc cgcctaaagt ggaaaaagag aaagaaaaaa cacaacgctg gatggtgcaa       540
     tgtggctcat tcaaagccgt tgatcaggca gaatctatcc gcgctcaatt ggcatttgcg       600
     ggtatcgaaa gccgtattac ctcgggcggt ggctggaatc gcgtggtgct tggcccctac       660
     aatagtaagg ctgccgcaga taaagccttg cagcgtttac aaggtgcagg tcaatcagga       720
     tgcattcccc tctctgttgg gggttga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page