(data stored in ACNUC9543 zone)

EMBL: CP000308.PE262

CP000308.PE262       Location/Qualifiers
FT   CDS_pept        complement(303685..304002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0262"
FT                   /product="transcriptional repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12231"
FT                   /db_xref="GOA:Q1CBE1"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBE1"
FT                   /protein_id="ABG12231.1"
FT                   /translation="MAEWNGEYVSPYAEHGKKSKQVKKITVSIPLKVLKILTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKILMRELGVDPDTWE
FT                   Y"
     atggctgagt ggaacggcga gtatgtcagc ccttacgctg aacacggcaa gaaaagcaag        60
     caggtcaaaa aaatcacggt atccattccg ttgaaagtgt taaaaatcct caccgatgag       120
     cggacccgcc gtcaggtgaa taacctgcgc catgctacca acagtgaatt gttgtgtgag       180
     gcctttttgc atgcatttac tggccagccg ctaccgaatg acgaagacct gcgtaaagaa       240
     cgcagtgatg agatcccgga agccgcgaaa attttaatgc gtgaattggg tgttgaccct       300
     gacacctggg aatattga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page