(data stored in ACNUC9543 zone)

EMBL: CP000308.PE271

CP000308.PE271       Location/Qualifiers
FT   CDS_pept        complement(314833..316161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0271"
FT                   /product="putative siderophore biosynthesis protein IucD"
FT                   /EC_number="1.14.13.59"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12240"
FT                   /db_xref="GOA:A0A0E1NPY0"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPY0"
FT                   /protein_id="ABG12240.1"
FT                   /translation="MNQPLDFIGIGIGPFNLSIAALGSEVSGFNSKFLERKPHFSWHPG
FT                   MMVPDCHMQTCFLKDLVSTVSPTNTYSFLNYLVQHKKFYRFLTTEHRTVSREEFADYLR
FT                   WAASGMSSLEFSQDIQSVDFDDQQRHFVVTTPRNVYHARHVCLGIGKRIKLPDCVTEQN
FT                   DRCFHASEMALRNPDLTGKRVTIVGGGQSGADLFLNIFLAAWGQPKQLNWISRRNNYNA
FT                   LDEAAFANEYFMPEYVESFYTLNDSAKQHMLAEQRMTSDGITSESLLAIYRAMYHQFEV
FT                   LHEKPWARLLPSRSLTNMHTRGNGYQLLTHHHLDQGTETFDTDVVIFATGYQQDRPAFL
FT                   DPLADRLQTTADCQYQVAPDFVLDWQGPRENCLFAVNAGMHSHGIAEPQLSLMAWRSAH
FT                   ILNRALGRTQFDLTSTPAVIQWRSQQSGVPAHPEHPVLNCIDI"
     atgaatcagc ctctggattt catcggcatt ggcatcggcc catttaacct cagtattgcc        60
     gcacttggca gtgaagtttc tggctttaac agtaaatttc tcgaacgtaa accgcacttt       120
     tcctggcacc ctggcatgat ggtgccggac tgccatatgc agacctgctt cctgaaagac       180
     ttggtcagca cagtctcccc gactaacacg tacagctttc ttaactatct ggtgcagcat       240
     aagaaattct accgttttct gaccaccgag caccggaccg tttcccgtga ggagtttgcg       300
     gactacctcc gttgggccgc cagtggcatg agttcgctcg agtttagcca agatattcag       360
     agcgtggact ttgacgacca gcagcgccat tttgtcgtta ccaccccgcg taatgtctac       420
     cacgcgcgcc acgtttgcct ggggataggc aaacgcatca aattgccaga ctgcgtgacc       480
     gagcaaaatg accgctgctt ccatgccagc gaaatggcac tgcgtaatcc agatctgacc       540
     ggtaaacgcg tcaccattgt gggcggcggc cagagcgggg cggacctgtt cctgaacatc       600
     tttctcgctg catgggggca gccaaagcag ctgaactgga tttcacgccg taacaactac       660
     aacgcgctgg atgaagccgc ttttgccaat gagtacttca tgccggaata cgttgagagt       720
     ttctacaccc tgaacgacag cgccaaacag catatgctgg cagaacagag aatgacctct       780
     gacggcatta ccagtgaatc actactggcg atttaccgtg ctatgtacca ccaatttgaa       840
     gtgttacatg aaaaaccgtg ggcgcgcctg ctccccagcc gctcactgac caatatgcat       900
     acgcgcggca acggttacca attactcacc catcaccatc tcgatcaagg cacagaaact       960
     tttgataccg atgtggtaat cttcgccacg ggttatcagc aggatcgacc ggcgtttctc      1020
     gatccattag ctgatcgtct gcaaaccacc gccgattgcc agtaccaagt ggctccagat      1080
     tttgtcctcg actggcaagg cccgcgtgaa aactgcttgt tcgccgtgaa tgccggtatg      1140
     catagccacg gcattgccga acctcagctc agcctgatgg cttggcgatc agcacatatt      1200
     ctcaaccggg ctttagggcg cactcagttc gatttaactt ccaccccggc ggtgatccaa      1260
     tggcgcagcc aacagtcggg tgtccctgcc cacccggaac atcccgtgct caactgcatc      1320
     gacatttaa                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page