(data stored in ACNUC9543 zone)

EMBL: CP000308.PE276

CP000308.PE276       Location/Qualifiers
FT   CDS_pept        320748..321971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0276"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12245"
FT                   /db_xref="GOA:A0A0E1NZZ4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZZ4"
FT                   /protein_id="ABG12245.1"
FT                   /translation="MRISSESDARSSGLTSSTHWPLAFCVGLLGIGQNGLLVVLPVLVS
FT                   RTHLSLSVWAGLLTLGSMLFLVGSAWWGRQSEIRGCKFVVIMALAGYLLSFVLLALAVW
FT                   GLSAGWLSEMAGLGWLIVARIIYGLTVSGMVPASQTWALQRAGYEQRMAALATISSGLS
FT                   CGRLLGPLCAALALSIHPIAPLWLMAIAPLIALLVVYRQYNDPPLPPVVHQQNRLRLNM
FT                   LPYLLCALLLAATVSLMQLGLAPHLSRLFSHSATTVSHHVAILLSIAAGCTLLAQFLVV
FT                   RPQRFTPPQLLLVAALLMVLGLGLMCVQPLVLFYLGCALASFGAAMATPGYQLMLNDRL
FT                   STGKGSGVIATSHTLGYGMSALMVPVVAKFYGESQLVAAAFMMAILLGGISGWLWCQHR
FT                   TTAHSVGE"
     atgcgcatat cctcagagtc tgacgctcgc tcaagcgggc ttacatcgtc tacccattgg        60
     cctttagcgt tctgcgttgg gttactgggc atcgggcaaa acggtttatt agtggtgtta       120
     ccggtattgg taagccgcac tcatctgtca ttgtcggtgt gggcgggtct attgacactt       180
     ggctcaatgc tatttttagt gggatcggca tggtggggcc ggcaatcgga gatccgtggc       240
     tgcaaatttg ttgtcatcat ggcactggca ggttacttgc ttagctttgt tttattggcg       300
     ctggcggtgt gggggttgtc agcagggtgg ttatcggaaa tggccggtct gggctggcta       360
     atcgtggctc gtattattta tggcctgacc gtctctggta tggtgcccgc tagccagacc       420
     tgggcactac agcgtgccgg ttatgagcaa cggatggcgg cgctggcgac catcagttcg       480
     gggctgagct gtggccgtct gctcggccca ttgtgtgccg ccctcgcgct ctcaatacac       540
     ccgatagccc ccctgtggct gatggcaatt gcaccactga tcgcactgct ggtggtgtat       600
     cgccaataca atgacccgcc gttaccccca gtggtgcatc aacaaaaccg tttacgcctc       660
     aatatgttgc cttatttact gtgcgcgttg ttgctagcgg caaccgtcag cctgatgcaa       720
     cttggcctgg cacctcactt aagtcgattg tttagccatt cggccaccac ggtgagccac       780
     cacgtggcca ttttgcttag catagccgcg ggttgtacgt tgctggcaca gtttctggtg       840
     gttcgtccac aacgttttac gccacctcag ttgctgctag tggcagcctt gctcatggtg       900
     cttggcttgg ggctgatgtg tgttcaaccg ctggtattat tctatctagg ttgtgcgctg       960
     gcttctttcg gcgccgcgat ggcgacaccg ggttaccaac tgatgttgaa cgaccggtta      1020
     tctactggca aaggctccgg cgtgatcgct accagccata cattgggcta tggcatgagt      1080
     gcattgatgg tgccggtagt cgcaaaattt tatggtgagt cacagttggt agccgcggcg      1140
     ttcatgatgg ccattttgtt ggggggaatc agtggctggc tgtggtgcca gcatcgaaca      1200
     accgcccatt ctgtgggaga gtaa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page