(data stored in ACNUC9543 zone)

EMBL: CP000308.PE281

CP000308.PE281       Location/Qualifiers
FT   CDS_pept        327958..328608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0281"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12250"
FT                   /db_xref="GOA:A0A0E1NWN3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWN3"
FT                   /protein_id="ABG12250.1"
FT                   /translation="MNGKIDRVTHALTCVSVWIGWFALSFSLLLFPGYVGIYRSGMATP
FT                   LLYIVFWLPFTLLAWKHYQKSFGLMPLGRITLQDMLIPGLALLGLTAIFQFFGQPEPWV
FT                   ESLLQPSTFTQILLVITICVFAPISEEIIFRGFLLNAGIGFGRRGRLLAVVITSLLFAL
FT                   VHTQYLYPATFVSLFVFSAILCEVRIRTGSLLMPMVLHSANNIASVAWVLTLS"
     atgaatggaa agattgaccg ggttactcat gccctgactt gtgtttctgt ttggatagga        60
     tggtttgcac tttcattttc cctgctgctg tttcctggct atgtgggaat atatcgctca       120
     ggtatggcga ctcctctgct gtacatcgtt ttctggctcc cctttacgct actggcgtgg       180
     aagcattatc agaagtcgtt tggactgatg ccgttgggaa gaataacctt gcaggatatg       240
     ctgattccgg gccttgcttt gctgggatta accgctattt ttcagttttt cggccagccg       300
     gaaccctggg tggaaagcct attacagcca tcaactttca ctcaaatttt gctggtgata       360
     accatttgcg tgtttgctcc gatttcggag gagattatct ttcgtgggtt cttactgaat       420
     gcgggaattg gttttggtcg cagagggcgg ttgctggcgg tagtgatcac ctcgctgttg       480
     ttcgctctgg tacacactca atatctctat ccggcgacgt ttgtttcgct attcgttttt       540
     tctgcgatcc tgtgtgaggt cagaatcaga actggtagcc tactgatgcc gatggtgctt       600
     cattctgcga acaatatagc ctccgtagct tgggtgctga cgttgagtta a                651
//

If you have problems or comments...

PBIL Back to PBIL home page