(data stored in ACNUC9543 zone)

EMBL: CP000308.PE283

CP000308.PE283       Location/Qualifiers
FT   CDS_pept        329522..329785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0283"
FT                   /product="insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12252"
FT                   /db_xref="GOA:A0A0E1NZT2"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZT2"
FT                   /protein_id="ABG12252.1"
FT                   /translation="MACINVHCPRCDSALVYRHGQNPKGQSRFRCRECRSVFQLTYTYQ
FT                   ARKPEVKGQIVDIAFSGTGVWDTARTLKIGINTVIRTLKNSC"
     atggcttgca ttaacgttca ttgtccccgt tgtgattctg ctttggttta tcgacatggt        60
     cagaacccta agggccaaag ccgtttccgc tgccgtgagt gccgctctgt attccaactg       120
     acctacactt atcaggccag aaagcccgaa gttaaagggc agatcgttga tatagccttt       180
     agcggcacag gtgtgtggga tacggcaaga acgctaaaaa tcggtatcaa taccgttatc       240
     cgcactttaa aaaactcttg ctga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page