(data stored in ACNUC9543 zone)

EMBL: CP000308.PE284

CP000308.PE284       Location/Qualifiers
FT   CDS_pept        331730..332230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12253"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMS6"
FT                   /protein_id="ABG12253.1"
FT                   /translation="MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNG
FT                   QEQRPLSEREKLNINKNNFNSVLAEFQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEP
FT                   ENVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRELENILKDDALSDELRAELAALAP
FT                   KEG"
     atgtcctctt caagcttcca aaatgagata cctaaagcac gcattaacat caaattagac        60
     ctgcatactg gcggggcgca aaagaaagtc gaactgcctt tgaagttgtt ggtgatgggc       120
     gattacagca acggtcagga gcagcgcccg ctgtctgaac gtgaaaaact caatatcaat       180
     aaaaataatt ttaacagtgt gctggctgaa ttccaaccga gcctgaaact cgctgtaccg       240
     gacacgctgg ccggggataa caccgataca gccgtctccc tgaccttcaa cgacatgaaa       300
     gatttcgagc cagaaaacgt ggcccgtcaa attccgcaac tgcgtgcctt gctggccatg       360
     cgcaacctgc tgcgagacct taaatccaat ctgctggaca acgccacctt ccgccgtgag       420
     ctggaaaata tcctcaaaga cgatgccttg agcgatgaac tgcgcgctga actggcggcc       480
     ctggcgccaa aagagggtta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page