(data stored in ACNUC9543 zone)

EMBL: CP000308.PE285

CP000308.PE285       Location/Qualifiers
FT   CDS_pept        332279..333817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12254"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX39"
FT                   /protein_id="ABG12254.1"
FT                   /translation="MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIE
FT                   AFQNNDALAEATTDERVTAAVSVFLDLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLD
FT                   AVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELLDISKDHLVQDFEDAPEISQSGLY
FT                   AQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAAHMPFIGSVGPEFFG
FT                   KENMEDVAAIKDIANYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVRS
FT                   FNYVEQVKGPDHDRYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYD
FT                   LGTGNQVKIPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADA
FT                   TANSRINARLPYIFLLSRIAHYLKLIQRENIGTTKDRRLLELNNWVRGLVTEMTDPGDD
FT                   LQASHPLRDAKVTVEDIEDNPGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA"
     atgtctgtac aggaaaaccg tgcgcagggt actgcgacga ccgtattaaa gaatagccct        60
     gcggcacaag gggtttacgc cgccttgttt gaaaaaatca acctgagccc ggtctcctca       120
     ctggccggta tcgaggcgtt ccagaacaac gatgcgctgg cggaagccac caccgatgag       180
     cgcgttaccg ccgccgtcag tgtcttttta gacctgctga agcagtcggc gaagaaagta       240
     gaaaaactgg ataaaaccct gctggacggc catattgccg cactggatga ccaaatcagc       300
     cgccagttgg acgcggtaat gcaccacccc gatttccagc gggtggaatc gacctggcgt       360
     ggtgtgaagt cgctgatcga tcagaccgat ttccgccaga acgtgcgcat cgagctgctg       420
     gatatcagta aagatcatct ggtgcaggat tttgaagatg ccccggaaat ctcacaaagc       480
     ggtttatacg cccagaccta tattcaggaa tacgacaccc ccggcggcga gccgattgcc       540
     gcggctatct ccaactacga gttcgaccgt agcccgcaag atatcgcgtt attgcgcaat       600
     atctccaagg tcgcggcggc agcccatatg ccgtttatcg gttccgttgg ccccgagttc       660
     tttggtaaag agaacatgga agacgtggca gccatcaaag atatcgccaa ctactttgac       720
     cgtgctgaat acatcaagtg gaaagccttc cgcgactcgg atgattcccg ctatatcggc       780
     ctgaccatgc cgcgcgtgct ggggcgtttg ccttacggcc cggacacggt gccggtacgc       840
     agcttcaact acgttgagca ggtgaaaggg ccggatcatg atcgctactt gtggaccaat       900
     gcctcatttg cctttgctgc taacatggtg aaaagcttca ttaaaaatgg ctggtgtgtg       960
     cagatccggg gcccgcaggc cggtggtgcg gtcaccaact taccgatcca cctgtacgat      1020
     ctgggtaccg gtaatcaggt caaaattccg tcagaggtga tgatcccgga aacccgcgag      1080
     ttcgagtttg ccaatctggg ctttatcccg ctgtcgtact acaaaaaccg cgattactcg      1140
     tgcttcttct cggccaactc ggcgcagaaa ccggcgctgt atgacaccgc ggatgccacg      1200
     gccaacagcc gcatcaacgc ccgtttgccg tatatcttcc tgctgtcgcg cattgcccat      1260
     tatctgaaac tgatccagcg cgagaacatc ggcaccacca aagatcgccg tctgctggag      1320
     ctgaacaact gggtgcgcgg gctggtgacg gaaatgactg atccgggtga tgatttgcag      1380
     gcgtcccatc ccctgcgtga tgccaaagtg acggtcgaag atatcgaaga caaccccggc      1440
     ttcttccgcg tcaagctgta tgcggtgccg catttccagg tggaagggat ggacgtcaat      1500
     ctgtcattgg tttcccaaat gccaaaggct aaggcataa                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page