(data stored in ACNUC9543 zone)

EMBL: CP000308.PE29

CP000308.PE29        Location/Qualifiers
FT   CDS_pept        complement(43830..45407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0029"
FT                   /product="maltose transport system permease protein MalF"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11998"
FT                   /db_xref="GOA:A0A0E1NUY7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUY7"
FT                   /protein_id="ABG11998.1"
FT                   /translation="MQLSHTELQSRKKKIAWWQSDALKWLVISLLSLFTCYLIVLMYAQ
FT                   GEYLFAIVTLILVSLGLYVFANRRAYAWRYVYPGVAGMGLFVLFPLICTIAIAFTNYSS
FT                   TNQLTFERAQSVLLDRQFQTGKTFTFGLYPSDNQWRLQLTNPDDGSLFISEPFSFEATG
FT                   EQKVMVAPTNTAQTSEPASLRIITQSRQALSSLVAILPDGAELRMSSLRQFSGTKPLYT
FT                   LGADGKELINQQTGVKYWPNPSTGFYQAVNADGQWENEKLSPGFTVSIGWKNFLRVLHD
FT                   EGIQKPFISIFIWTILFSVMSVTFTVAVGMVLACVVQWDSLKGKAIYRVMLILPYAVPS
FT                   FISILIFKGLFNQSFGEINLMLSHLFGIKPAWFSDPITAKSMILIVNTWLGYPYMMILC
FT                   MGLLKAIPDDLYEASAMDGAGPFQNFFRITFPLLIKPLTPLMIASFAFNFNNFVLIQLL
FT                   TNGGPDMIGTSTPAGYTDLLVNYTYRVAFEGEGGQDFGLAAAIATLIFILVGALAILNL
FT                   KASKMNFD"
     atgcagttat cccacaccga gcttcaaagc cgaaaaaaga aaatcgcctg gtggcagagt        60
     gatgcgctta aatggttggt tatcagcctg ttaagcctct tcacctgtta tttgatcgtg       120
     ttgatgtatg ctcaaggtga atatcttttt gccatcgtga cgctgatttt ggtgagttta       180
     gggctgtatg tgtttgccaa ccgccgcgct tatgcctggc gctatgttta ccccggcgtg       240
     gccggtatgg ggctgtttgt tctcttcccc ttaatttgta ctatcgccat cgcctttact       300
     aactacagca gtaccaacca attaaccttc gaacgtgctc aatccgtctt gctggatcgg       360
     cagttccaga ccggtaaaac atttaccttt ggtctctatc ccagcgataa ccaatggcgt       420
     ttacagctta ccaacccaga cgacggtagc ctgttcatct ctgaaccctt cagttttgag       480
     gccacgggtg agcaaaaagt gatggtcgcc ccaaccaata cggcacaaac gagtgaaccg       540
     gcatcactgc ggattattac ccagagtcgt caggcgctaa gtagcttagt ggctatcctg       600
     cctgatggtg ctgaactgcg tatgagttca ttacgtcaat tttccggcac caagccgctc       660
     tatactctgg gtgccgatgg taaagaactg attaatcagc aaaccggcgt gaaatattgg       720
     ccgaatccta gtaccgggtt ctatcaagcg gtcaacgctg atgggcagtg ggaaaatgaa       780
     aagcttagcc ccggctttac cgtgtctatc ggctggaaaa acttcctgcg ggtactgcac       840
     gacgaaggga ttcaaaagcc gttcatctcg atctttatct ggactatcct cttttcggta       900
     atgagcgtga cctttacggt agctgtcggc atggtgctgg catgtgtggt gcaatgggat       960
     tcgctgaaag gtaaagctat ctatcgagtg atgctgatcc tgccctatgc ggtaccgtcg      1020
     tttatctcta ttttgatttt caaagggtta tttaaccaaa gtttcggtga aatcaacctg      1080
     atgctcagcc atttatttgg catcaaaccc gcctggttca gtgatcctat caccgccaaa      1140
     agcatgattt tgatcgtgaa tacctggctc ggttatccct acatgatgat tttgtgcatg      1200
     gggctgttga aagcgatccc tgacgacttg tatgaggcat cggcaatgga tggcgcaggg      1260
     ccattccaga actttttccg catcacattt ccgttactga ttaagccact gacaccgctg      1320
     atgattgcca gttttgcctt taactttaat aacttcgtgc taatccagct attgaccaac      1380
     ggggggcccg atatgattgg taccagcacc ccagcggggt ataccgattt gctggttaac      1440
     tatacctatc gtgtcgcctt tgaaggcgaa ggcgggcagg acttcggttt ggcagccgct      1500
     atcgcaaccc tgattttcat tttggtaggc gcactcgcga tactgaattt gaaagccagc      1560
     aaaatgaatt ttgactaa                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page