(data stored in ACNUC9543 zone)

EMBL: CP000308.PE291

CP000308.PE291       Location/Qualifiers
FT   CDS_pept        341158..343506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12260"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWB5"
FT                   /protein_id="ABG12260.1"
FT                   /translation="MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDI
FT                   QFTSADKAIDPATMLMHDASLTLAAPMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEEC
FT                   RYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILRERHDMRGQDFVFTLAREYPRREQ
FT                   VMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQGLTLQAVPPSGM
FT                   HDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYADN
FT                   YLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALSPGQELKVTGNDVPAQ
FT                   FGKGVIVTRITSHARRDRSYEVHFEAIPYSEEYCFRPILINKPKMAGTLPARVTSTTVN
FT                   DTYGHIDKDGRYRVNLMFDRDSWEQGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAF
FT                   EDGNPDRPYIASVLHDSAHGDHVTISNYKRNVLRTPSNNKLRLEDERGKEHIKLSTEYG
FT                   GKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGIFISADGQAKAQGQVLEMQPAI
FT                   SLLKSAQEQMEAISADAQTATASPANLQVQISLLQQNLTELKQAVLLLSAPKGIALSSG
FT                   EHLQLSASENLIATAGKNADVSVGKNFFIGVGNTLSVFVRKLGIKLIANQGRITVQAQN
FT                   DLMELLARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYY
FT                   GRQEKANKPEDFPSVAPETTEPTSHFTFS"
     atgaatacca ctctcccgac tcttcggttt gaccatagcc accacaaact ggtggtccgc        60
     gacagcaccg ccgccgttga tgtgctgggc tttgaaggcc acgaaagcct gagccagccg       120
     ttctgttacg acatccaatt caccagcgcc gacaaggcga ttgacccggc gaccatgctg       180
     atgcacgacg cgtcactgac attggcggcc ccgatggccg aagcttttgg cgtgacggtt       240
     cagcagaccc agcgggtgat ccaaggggtg gtgaccggat ttaaacgcct gtcggcctcg       300
     aaagaggaat gccgctacga actgagcctg caaccgcgcc tggccttgtt gtcgcgcagc       360
     catcagaacg ggatatatca ggacatgtcg gtgccgcaga ttgtggaaaa aattctgcgt       420
     gagcgccatg acatgcgcgg tcaggatttt gtcttcacgc tggcccgcga gtacccacgc       480
     cgcgagcagg taatgcaata cggcgaggat gacctgacct ttatccgccg cctgctggcc       540
     gaggtgggga tctggtttcg ttttaccgcc gatcccaaac tcaatattga tgtggtggag       600
     ttttacgacg accagcgctt ctatcagcaa ggactgacgc tacaggcggt gccgccttcg       660
     gggatgcacg acagcgggat ggagtcggtc tgggacttgt ccagtgctca tcaggtggtt       720
     gaaaaatcgg tcagtaccgg cgattacaac taccgcaccg ccactgccga tatgacggcc       780
     ggggcagaca tcactcgggg tgataccacc acctacggcg aagcttatca ttacgccgat       840
     aactacctga ccgcaggcag tgaagggcgc gagccggaaa gtgaaagcgg ggccttttat       900
     gcccgtctgc gccatgaacg ttacctcaat aatcaggcgc gcttcgccgg ggtggccaat       960
     gcggcggcac tgtcaccggg tcaggaactg aaagtcaccg gcaacgacgt gccagcacag      1020
     tttggcaaag gggtgatagt cacccgcatc accagccacg cccgccgcga ccgcagctat      1080
     gaagtgcatt ttgaggccat cccttactcc gaagagtatt gcttccgccc gatcctcatc      1140
     aacaagccaa aaatggccgg caccttgccc gcacgggtca ccagcaccac ggtgaacgac      1200
     acttacggac acatcgacaa agacggccgc taccgtgtca atctgatgtt tgaccgggac      1260
     agttgggagc aaggttacga aagcctgtgg gtccgtcagg cccgcccgta tgcgggtgac      1320
     agctacggcc tgcacctgcc gctgctggcc ggcaccgaag tggcgattgc atttgaggac      1380
     ggcaacccgg accggccgta tatcgcctct gtgctgcacg actcggcgca cggcgaccac      1440
     gtcaccatca gcaactacaa acgcaacgta ctgcgcactc cgtcgaacaa caaactgcgc      1500
     ctggaggatg aacggggcaa agagcacatc aagctcagca ccgaatacgg cggcaaaagc      1560
     cagttgaatc tggggcatct ggtcgataac gagaaacagc ctcggggtga gggttttgag      1620
     ctgcgcaccg acagttttgg tgccttgcgg gcagaaaaag ggattttcat cagcgctgac      1680
     ggccaggcga aggcacaggg gcaggtgctg gagatgcaac cggctatcag cctgttgaaa      1740
     agtgcgcagg aacagatgga ggccatctcc gcggatgcac aaaccgccac cgccagtccg      1800
     gccaacctac aggtacaaat cagtctgttg cagcaaaatc tcactgaact gaaacaagct      1860
     gtcctgttac tgagtgcgcc aaaggggatc gcgttgagca gtggcgaaca tttacaactg      1920
     tcggccagcg aaaatctgat agccactgcc ggtaagaatg cggatgtcag tgtaggtaag      1980
     aattttttta tcggtgtggg caacacgctg agcgtatttg tacgcaagct ggggataaag      2040
     ttgatagcga atcagggacg aataacggta caggcccaga atgatctgat ggagttattg      2100
     gcgcgtaaag cgatcacgat caccagcacc gaggatgaga taaaaatcac cgccaagaag      2160
     aagatcacgc tgaatgcggg aggcagttat atcacgctgg atgagaaccg gatcgagtca      2220
     ggaacggcgg gggaatattt gaccaaagca gggtattacg ggcgacagga aaaggcaaat      2280
     aaaccagaag attttccgag tgttgccccg gaaacaacag aacccaccag tcatttcact      2340
     ttttcctga                                                              2349
//

If you have problems or comments...

PBIL Back to PBIL home page