(data stored in ACNUC9543 zone)

EMBL: CP000308.PE293

CP000308.PE293       Location/Qualifiers
FT   CDS_pept        346640..346915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0293"
FT                   /product="insertion sequence protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12262"
FT                   /db_xref="GOA:A0A0E1NNC9"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNC9"
FT                   /protein_id="ABG12262.1"
FT                   /translation="MAKVDVKCPFCEQFHPVKKHGPERTGHQRYRCQACRRSFQLEYEY
FT                   RACYPGMKEQIVDLAMNNAGIRDTARALHISINAVMRTLKNSRRSV"
     atggctaagg ttgatgtgaa atgtccattt tgtgagcagt ttcaccctgt taaaaagcac        60
     gggccagaac gcacagggca tcagcgctac cgctgtcagg cctgccgacg gagctttcaa       120
     ctagagtacg agtatcgtgc ctgctacccc ggtatgaaag agcaaattgt cgatcttgct       180
     atgaacaatg ccggtattcg tgatactgca cgggcgttgc atatcagtat caatgcggtc       240
     atgcgcactt taaaaaactc tcgccgcagc gtgtaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page