(data stored in ACNUC9543 zone)

EMBL: CP000308.PE295

CP000308.PE295       Location/Qualifiers
FT   CDS_pept        347836..348471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12264"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSK4"
FT                   /protein_id="ABG12264.1"
FT                   /translation="MQPAISLLKSAQEQMEAISADAQTATASPADLQAQISLLQQNLTE
FT                   LKQAVLLLSAPKGIALSSGEHLQMSASENLIATAGKNADVSVGKNFFIGVGNTLSVFVR
FT                   KLGIKLIANQGPITVQAQNDLMELLARKAITITSTEDEIKITAKKKITLNAGGSYITLD
FT                   ENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAAKTEDPIKRWLFS"
     atgcaaccgg ctatcagcct gttgaaaagt gcgcaggaac agatggaggc catctccgca        60
     gatgcacaaa ccgccaccgc cagtccggcc gacctgcagg cacaaatcag tctgttgcag       120
     caaaatctca ctgaactgaa acaagctgtc ctgttactga gtgcgccaaa ggggatcgcg       180
     ttgagtagcg gggagcatct gcaaatgagt gccagcgaaa atctgatagc cactgccggt       240
     aagaatgcgg atgtcagtgt aggtaagaat ttttttatcg gtgtgggcaa cacgctgagc       300
     gtatttgtac gcaagctggg gataaagttg atagcgaatc agggaccaat aacggtacag       360
     gcccagaatg atctgatgga gttattggcg cgtaaagcga tcacgatcac cagcaccgag       420
     gatgagataa aaatcaccgc caagaagaag atcacgctga atgcgggagg cagttatatc       480
     acgctggatg agaaccggat cgagtcagga acggcggggg aatatttgac caaagcaggg       540
     tattacgggc ggttagataa ggccaagctc ccaactgaat ttccagcctt agccgctaaa       600
     actgaagacc ccattaaacg ttggctattc tcttaa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page