(data stored in ACNUC9543 zone)

EMBL: CP000308.PE297

CP000308.PE297       Location/Qualifiers
FT   CDS_pept        350771..351538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P0H6"
FT                   /protein_id="ABG12266.1"
FT                   /translation="MINIKKLTLKYFYILFFTPHLAHATYYNEVSFDDYIVLLDKNENA
FT                   ILHVKKNHTDIQCVIKNWNIKYNNGAGVISLTTDKKAILLANTQAYLYVDEVINCKEGG
FT                   VSLHKVPVPNSPPFGTVIDLNFDKKIYLSVVLEDIRTLSYTAIVSKFDSNKNIINAKGF
FT                   ENKQTTNKDNSFYLEGSSGGYGGKISINGKYIFPVNLDCSSDSFPGVWDLENKKRVVFS
FT                   SHKNSSITIDEKCHKLFNGVASLEELGGELVSK"
     atgataaata ttaaaaaatt gacattgaaa tatttttata ttttattttt tacaccccac        60
     ttagcacatg ctacgtatta taatgaagtg tcatttgatg attacatcgt tttattagac       120
     aaaaatgaaa atgcaatttt gcatgtaaaa aaaaaccata ctgacattca atgtgtaatt       180
     aaaaattgga atataaagta caacaatggc gcgggtgtca tatcactaac aacggataag       240
     aaggccatcc ttttggccaa tacacaggca tatctttacg tagatgaagt gattaattgc       300
     aaggaagggg gagtttcatt acacaaagtc cccgttccaa actcaccccc atttggcacc       360
     gtaatagatt taaactttga taaaaaaatc tatctttctg tagtattaga agatataagg       420
     accttgagtt atactgccat cgtgtctaaa ttcgatagca ataaaaatat aattaatgcc       480
     aaagggtttg aaaataaaca gacaactaat aaagataatt cattttattt agaaggatca       540
     agcggcggat acggtggtaa aatatccata aatgggaagt atatcttccc tgtcaatctg       600
     gactgttcct ctgactcatt ccctggggtc tgggatctcg aaaacaaaaa aagagttgta       660
     ttctcatcac ataaaaatag cagcatcact atagatgaaa aatgtcataa acttttcaac       720
     ggtgtggcca gtctagaaga acttggaggg gagttagtct caaaataa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page