(data stored in ACNUC9543 zone)

EMBL: CP000308.PE299

CP000308.PE299       Location/Qualifiers
FT   CDS_pept        351963..352331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0300"
FT                   /product="insertion sequence protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12268"
FT                   /db_xref="GOA:A0A0E1P1B6"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P1B6"
FT                   /protein_id="ABG12268.1"
FT                   /translation="MWSFVGNKKQQRWLWYAWESRLKRIIAHVFGRRSKKTFRQLLGLL
FT                   SGFNIVFWCTDNFSAYEMLPDEKHIRSKLYTQRIERENLNIRNRLKRLNRKTLGDSKSA
FT                   EMHDRIIGTFIEREHYLV"
     atgtggtcat ttgtgggcaa caaaaagcag caacgttggc tttggtatgc ctgggagtct        60
     cgcctcaaac gtattattgc tcatgttttt ggtcgtcgga gcaaaaagac atttcgccaa       120
     ttattggggt tgctgtcagg tttcaatatc gtcttctggt gtaccgacaa cttcagtgct       180
     tatgagatgt tgccggatga aaaacacatc aggagcaagc tttacacgca gcggattgag       240
     cgtgaaaacc tgaatatccg taatcggttg aaacgactga accgcaagac tctcggagac       300
     tcaaagtcgg cagaaatgca tgacaggatc atcggtacgt tcattgagcg tgagcattac       360
     ctagtgtga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page