(data stored in ACNUC9543 zone)

EMBL: CP000308.PE30

CP000308.PE30        Location/Qualifiers
FT   CDS_pept        complement(45594..46805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0030"
FT                   /product="maltose-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11999"
FT                   /db_xref="GOA:A0A0E1P2V5"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P2V5"
FT                   /protein_id="ABG11999.1"
FT                   /translation="MTRSFTKSGIGKTARVLALSALTTLVLSSSAFAKIEEGKLVIWIN
FT                   GDKGYNGLAEVGKKFEKDTGIKVTIEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYA
FT                   QSGLLAELTPSKAFQEKLFPFTWDAVRFNGKLIGYPVAVEALSLIYNKDLVKEAPKTWE
FT                   EIPALDKTLRANGKSAIMWNLQEPYFTWPVIAADGGYAFKFENGVYDAKNVGVNNAGAQ
FT                   AGLQFIVDLVKNKHINADTDYSIAEAAFNKGETAMTINGPWAWSNIDKSKINYGVTLLP
FT                   TFHGQPSKPFVGVLTAGINAASPNKELATEFLENYLITDQGLAEVNKDKPLGAVALKSF
FT                   QEQLAKDPRIAATMDNATNGEIMPNIPQMAAFWYATRSAVLNAITGRQTVEAALNDAAT
FT                   RITK"
     atgactcgca gcttcacgaa atccggcatt ggtaagaccg cacgtgtttt ggctctttcg        60
     gcgttaacca cgctggtgct ctcttcctct gcttttgcca aaattgaaga aggtaaactg       120
     gttatctgga tcaatggcga taaaggttat aacggattgg cagaggtcgg taagaaattt       180
     gagaaagata ccggcatcaa agtgaccatc gagcatccag ataaattgga agaaaaattc       240
     ccacaagtcg ccgcaaccgg tgatggcccg gacattatct tctgggccca tgaccgtttt       300
     ggtggctatg cacaatcagg tttactggct gaactgaccc catcgaaagc cttccaggaa       360
     aaattgttcc cattcacttg ggatgccgtt cgctttaatg gcaagctgat tggttaccct       420
     gttgcagtcg aagcgctgtc actgatttac aacaaagatc tggtgaaaga agcaccaaaa       480
     acgtgggaag agatccctgc actggataaa acactgcgtg ctaatggcaa aagcgccatt       540
     atgtggaacc tacaagaacc gtacttcact tggcccgtta tcgccgctga tggcggttat       600
     gcattcaagt ttgaaaacgg ggtttatgat gcgaagaacg tgggcgtaaa taatgcgggc       660
     gcccaagctg gcctacaatt tattgtcgat ctcgttaaga ataagcacat caatgccgat       720
     actgattact ccatcgcaga agcagccttt aataaaggtg aaaccgcgat gaccattaat       780
     ggcccatggg catggtccaa tatcgataag agtaaaatta attacggcgt aaccctgctg       840
     ccaaccttcc atggccagcc atctaaaccc tttgtcggtg tactgaccgc cggtattaac       900
     gcagcgagtc caaataaaga actggcaacg gaattcctgg aaaactatct gatcaccgac       960
     caaggcctgg ctgaggtcaa caaagataaa ccactgggtg ccgtagcgct gaaatcattc      1020
     caggagcaac tggcaaaaga tccgcggatt gcagcaacaa tggataacgc caccaacggc      1080
     gaaatcatgc caaacattcc gcaaatggca gccttctggt atgccacccg tagtgcggta      1140
     ctgaacgcca tcactgggcg tcaaaccgtt gaagcggcac tgaacgatgc ggcaacccgt      1200
     atcacgaagt aa                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page