(data stored in ACNUC9543 zone)

EMBL: CP000308.PE301

CP000308.PE301       Location/Qualifiers
FT   CDS_pept        353658..353906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0302"
FT                   /product="integrase"
FT                   /note="putative partial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12270"
FT                   /db_xref="GOA:A0A0H2Y4V4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4V4"
FT                   /protein_id="ABG12270.1"
FT                   /translation="MDSPPLRSFFRRLSVECRCTISPHRFRHTIATEMMKSPDRNLKVV
FT                   QTLLGHSSIAVTLEYVEGDIDSLRLALEETFERKEVF"
     atggacagtc ccccgttacg ttctttcttc cgcaggcttt cagtcgaatg ccgttgtacg        60
     attagtccac accgatttcg acacactatc gccactgaga tgatgaaatc accggatcgt       120
     aatctgaaag tggttcagac cctgctaggg cattcaagta ttgcggtcac gttggaatat       180
     gttgagggcg atatagacag cctcagattg gcgttggaag agactttcga gagaaaagag       240
     gttttttaa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page