(data stored in ACNUC9543 zone)

EMBL: CP000308.PE307

CP000308.PE307       Location/Qualifiers
FT   CDS_pept        complement(361224..363368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0308"
FT                   /product="putative hydroxamate-type ferrisiderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12276"
FT                   /db_xref="GOA:A0A0E1P070"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P070"
FT                   /protein_id="ABG12276.1"
FT                   /translation="MNKINMFMLSTFMRSMFMRSTLIPSTFILSTLLLPAVVLAEDTII
FT                   VERNRSQTDSYQATTSVTANRSPANIIDTPQNVTVVTHPVLEDYDVTNLGEALYFVSGI
FT                   TQSNTLGGTQDALIKRGFGNNRDGSILHDGIRSIQARNFTPTSERVEVLKGPSSMLYGM
FT                   NEPGGLINVISKKPQLDPHVHLEANASSFKGGGGQLDVTGPLGESGFAGRLIIDHQETD
FT                   YWRNFGRNRQTVVAPSLDWYGENTTVHLAWERMEYLVPFDRGTVIDPRTGKPVDTPRDR
FT                   RFDESYNATRGDQDTVTFSINHDLNEFWSTQLNYAFSRNSYSDNQARATAFNAETGVLT
FT                   RQSDATANAKSHSQAVQWVVNGDLDWGFTHHQLMFGIDYEARRVFRGDMIRGSKNNGFN
FT                   VYDPIYGTLPPSTAVSAADSDQRENIDSRALFIQDSMRLNEHWLLLGGLRYDSFDVMAG
FT                   KGRPFKKNTDSSDSRLVPRAGVVYNLNDWSSLYVSYTESFKPNVSIATAIDALPPEYGK
FT                   SWEAGYKIDINNRVTGTLAVYDIHKRNIMVSELVDGETVTRTAGKARSRGLELDMAGKV
FT                   TDSLSLIGSYAYTDARLTEDPDNNGNDLPNVARHTAALFLSRDFGSTSLISGDEVKAGI
FT                   GARYVGKRAGDAANSFWLDNYTVADAFIAWKMPLSGYQLKWQLNVKNLFDKTYYPSSAN
FT                   NLRIAIGEPRQVVLQGSIDF"
     atgaataaaa taaacatgtt catgctatcc acgttcatgc gatccatgtt catgcgatct        60
     acgttgatac cctctacgtt catactgtcc acactactgc tgccggctgt cgtgttggca       120
     gaagatacga taatcgttga gagaaataga tcgcaaactg atagctatca agcgaccacc       180
     agcgtgacag ccaatcgatc gccagccaac attatcgata ccccgcaaaa cgtgactgtc       240
     gtgacacatc cggtgttgga agattatgat gtgaccaatc ttggcgaggc gctttatttt       300
     gtcagcggga ttacccaatc caacacgctg ggtggcacgc aagatgcgct gattaagcgc       360
     ggtttcggca ataaccgtga cggctcaatt ctgcacgatg gcatacgctc aattcaggca       420
     cgtaacttca cgcccaccag cgaacgcgtc gaggtgctga aaggcccctc ctccatgcta       480
     tacggtatga atgaaccggg tgggctgatc aatgtgatca gcaaaaagcc acaactcgat       540
     ccccatgtgc atttggaagc caacgccagt agtttcaagg gtggcggtgg ccaacttgat       600
     gtaaccggcc ccttggggga atccggcttt gccgggaggc tgattatcga tcatcaggag       660
     accgattact ggcgtaactt tggccgtaac cgccagactg tggtcgcgcc atcgcttgac       720
     tggtacggtg aaaacaccac cgtacacctc gcttgggaac gaatggagta tttggtaccg       780
     ttcgaccgtg gcacggtgat tgacccacgc actggcaaac ccgtcgacac gccgcgtgat       840
     cgccgtttcg acgagagcta taacgccacc cgcggcgatc aagacaccgt cacgtttagc       900
     atcaaccacg atctgaacga gttctggtcc acacagctaa attatgcttt cagccgcaat       960
     agctatagtg ataatcaggc acgcgccact gcatttaacg ctgaaaccgg cgtattgacc      1020
     cgccagtcgg atgctaccgc taacgccaag agccattcgc aggcggtgca gtgggtagtc      1080
     aatggtgatc tcgattgggg tttcactcat caccaactga tgtttggtat cgattatgaa      1140
     gcccgccgcg ttttccgtgg cgacatgata cgcggcagca aaaacaacgg gtttaatgtc      1200
     tatgacccaa tttatggcac tctgccccca tccacagccg tcagtgctgc tgatagcgat      1260
     cagcgggaaa atatcgatag ccgcgcgctg ttcattcaag actcgatgcg cctaaacgag      1320
     cactggctat tactcggtgg cctgcgctac gacagcttcg atgtgatggc aggtaaaggc      1380
     cgcccattca aaaagaatac cgacagttcc gatagccgct tggtgccgcg cgccggggtg      1440
     gtttacaacc tgaacgactg gtcaagccta tacgtcagct acaccgagtc ctttaaaccg      1500
     aatgtctcta tcgccaccgc cattgatgcg ttaccccccg aatacggtaa atcgtgggag      1560
     gcgggctaca aaattgatat caacaaccgt gtaaccggta cgctcgcggt ctacgatatc      1620
     cataaacgta acattatggt cagcgagctg gtagacggcg aaacagtcac acgtaccgcc      1680
     ggtaaggcgc gttcacgcgg cctggaactg gatatggctg gcaaagtgac cgactcactg      1740
     agtctcattg gcagctatgc ctataccgat gcacgcctga ctgaagaccc ggataacaat      1800
     ggtaacgacc tacccaacgt ggcacgccac actgcggcac tgtttctgag ccgggacttc      1860
     ggcagtacgt cattgatttc aggcgatgaa gtgaaagcag gtattggcgc acgctatgtc      1920
     gggaaacgtg ctggcgacgc cgccaacagt ttctggctag ataactacac cgtagcggac      1980
     gcgtttatcg cctggaagat gccgctctcc ggctatcaac tcaaatggca gcttaatgtg      2040
     aaaaacctgt tcgataagac gtactatccg tcgagcgcta acaacctgcg tatcgctatc      2100
     ggcgaaccac gtcaggttgt gttgcagggc agtatcgatt tctaa                      2145
//

If you have problems or comments...

PBIL Back to PBIL home page