(data stored in ACNUC9543 zone)

EMBL: CP000308.PE313

CP000308.PE313       Location/Qualifiers
FT   CDS_pept        368624..368950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12282"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPI4"
FT                   /protein_id="ABG12282.1"
FT                   /translation="MAKNRSRRLRKKMHIDEFQELGFSVQWAFDEGTSVDVIDETVDAF
FT                   IDEVIEANGLAFDGSGYLQWEGLICLQEIGHCTDEHRALVTKWLEARKLKNVETSELFD
FT                   IWWD"
     atggctaaga atcgcagtcg tcgtttacgc aaaaagatgc atatcgacga gtttcaagaa        60
     ttgggttttt ccgtacagtg ggcttttgat gaaggcacta gcgttgatgt gattgatgaa       120
     accgttgatg cgtttatcga tgaagtcatt gaagcgaatg gtctggcatt tgacggaagt       180
     ggttatttac agtgggaagg cctgatttgc ctacaagaaa tcggtcattg tactgatgag       240
     caccgtgctc tggtcaccaa atggttagaa gcacgtaagt tgaaaaatgt agaaaccagt       300
     gagttatttg atatctggtg ggattga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page