(data stored in ACNUC9543 zone)

EMBL: CP000308.PE315

CP000308.PE315       Location/Qualifiers
FT   CDS_pept        370099..370629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12284"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVF3"
FT                   /protein_id="ABG12284.1"
FT                   /translation="MLHKIKVLRTAGLALLMLTAGQAQAEYQCSVKPQDDVIISPQSVQ
FT                   IVGASGNLQISPDGDVTRNGKTLTLTDAQRQQAFRYQTALRKDLPWIDQGAQQRLEKAR
FT                   VSLDKVIVQQLGSSSNVRNRLTTLSEQLKQQMARIIEKRSDGLAFHHQAIAQVEKEAVS
FT                   WSSRAWVACCRIA"
     atgttacata aaataaaagt attacgtact gcagggttgg cattgttgat gctcactgct        60
     gggcaggcgc aggctgaata ccagtgcagc gtaaaaccac aagatgatgt gatcatcagc       120
     ccgcaatctg tacaaattgt cggggccagt ggcaatttac agatttcacc tgatggtgat       180
     gtcacgcgta atggcaaaac gttgacgcta actgatgctc agcgccagca ggcattccgt       240
     tatcagacag cattgcgtaa agacttgcca tggattgatc agggcgcgca gcaacgtttg       300
     gaaaaagcac gggtttcttt ggataaagtc attgttcagc aactcggtag cagcagtaat       360
     gtccgtaacc gtctgacgac gttaagtgag caactcaagc agcagatggc tcgcattatc       420
     gagaaacgca gtgacggttt agctttccac catcaggcga ttgctcaggt agaaaaagag       480
     gccgtgagtt ggtccagcag agcatgggtg gcgtgttgca ggatagcctg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page