(data stored in ACNUC9543 zone)

EMBL: CP000308.PE321

CP000308.PE321       Location/Qualifiers
FT   CDS_pept        complement(382956..383510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0322"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12290"
FT                   /db_xref="GOA:A0A0E1NZU9"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZU9"
FT                   /protein_id="ABG12290.1"
FT                   /translation="MLTLTFLAKTVIDLYVMVLLLRIWMQWVHSDFYNPLSQFVVKITQ
FT                   PIVGPLRRVVPSMGPIDSASLLLAFLLMTIKYPLLLLIDSGSLSLSIYNLLFGLIALVK
FT                   AVGYLIFWVMIIRALMSWISQGRSPVDYLLLQLTEPLMAPIRRILPAMGGIDFSAMVVI
FT                   LILYLLNFLGMDLFGAMWVML"
     atgctaacgc tgacttttct ggcaaaaacg gtcattgacc tatatgtgat ggtgctgttg        60
     ttgcgcatct ggatgcagtg ggttcacagt gatttctata acccattgtc tcaatttgtg       120
     gtgaaaataa cccaacctat tgttggccca ctgcgccgag tggttccctc tatggggcca       180
     atcgatagcg catcattgct gttggcattt ttactgatga ccattaaata cccgctgcta       240
     ttactgattg atagcggatc cttatcactc agtatttata acctcttgtt cggccttatt       300
     gcgctggtaa aagcggtggg ttacctgatt ttctgggtca tgattatccg tgcgctgatg       360
     agttggatca gtcagggtcg tagcccggta gactacctgc tgctgcagtt aactgaacca       420
     ttaatggcac cgattcgccg tattttgcct gcgatggggg gtatcgattt ctcagcaatg       480
     gttgtcatcc ttatcttgta tctgctcaac tttttaggca tggatctatt tggagcgatg       540
     tgggtcatgc tgtga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page