(data stored in ACNUC9543 zone)

EMBL: CP000308.PE323

CP000308.PE323       Location/Qualifiers
FT   CDS_pept        complement(384752..385450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12292"
FT                   /db_xref="GOA:A0A0E1NTA5"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTA5"
FT                   /protein_id="ABG12292.1"
FT                   /translation="MSTIQQNLQDVRARIATAAHNCGRSPEEVTLLAVSKTKPVAAIEK
FT                   AIAAGQYAFGENYVQEGVDKIHSFVDNKTLEWHFIGPLQSNKSRLVAENFAWCHTVDRL
FT                   KIAQRLSAQRPAAMPALNVLIQINISDEQSKAGISLSELPALADSISTLPNLCLRGLMA
FT                   IPAPEHDYQRQLAVFTQMNQAFLTLKARYPQIDTLSMGMTDDMDAAISAGSTLVRIGTA
FT                   IFGARVYNAD"
     atgagtacta tccaacagaa tctacaggat gtcagagcgc ggatcgcaac ggctgcacac        60
     aattgcgggc gctctccaga agaagttaca ttgcttgcag tcagtaaaac caaacctgtg       120
     gcggctatcg aaaaagccat cgccgctggg caatatgctt ttggtgaaaa ctatgtgcag       180
     gaaggggtgg ataaaattca ctccttcgtg gataacaaaa cgcttgaatg gcactttatc       240
     gggccgctgc aatccaataa aagccggtta gtggctgaaa attttgcctg gtgtcatacc       300
     gttgatcggt tgaaaatagc ccagcgtctg agtgcccagc gcccagcggc tatgccagcg       360
     ttaaacgtac tgattcagat taatatcagt gatgagcaaa gcaaagcggg gatttccttg       420
     agtgaactcc ccgccttggc tgacagcatt agtacattac ctaacctgtg tttacgcggg       480
     ctgatggcta tcccagcgcc agaacatgat tatcagcggc aattggccgt atttacgcaa       540
     atgaatcagg cgttcttgac tttaaaagcc cgctaccctc agatagatac actttctatg       600
     gggatgactg atgatatgga cgccgccatt agcgccggca gtacactggt tcgaattggt       660
     accgccattt ttggtgcccg cgtttataac gcggattaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page